Comparing RR42_RS07775 FitnessBrowser__Cup4G11:RR42_RS07775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
47% identity, 90% coverage: 27:294/297 of query aligns to 7:274/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
47% identity, 90% coverage: 27:294/297 of query aligns to 8:275/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
48% identity, 82% coverage: 27:269/297 of query aligns to 5:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 77% coverage: 36:265/297 of query aligns to 5:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 77% coverage: 36:265/297 of query aligns to 5:223/225 of 4zv2A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 80% coverage: 28:265/297 of query aligns to 6:234/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 81% coverage: 27:266/297 of query aligns to 2:229/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
33% identity, 74% coverage: 47:265/297 of query aligns to 22:227/229 of 6svfA
Sites not aligning to the query:
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
28% identity, 79% coverage: 30:265/297 of query aligns to 8:239/246 of 4ohnA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
28% identity, 72% coverage: 59:271/297 of query aligns to 77:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
28% identity, 72% coverage: 59:271/297 of query aligns to 76:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
28% identity, 72% coverage: 59:271/297 of query aligns to 76:281/287 of 6h1uA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
30% identity, 77% coverage: 37:265/297 of query aligns to 5:221/226 of 8eyzA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 80% coverage: 25:263/297 of query aligns to 1:229/247 of 2yjpA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
26% identity, 77% coverage: 37:265/297 of query aligns to 6:226/234 of 3k4uE
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
26% identity, 81% coverage: 28:269/297 of query aligns to 1:235/237 of 4i62A
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
27% identity, 78% coverage: 36:266/297 of query aligns to 2:229/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
27% identity, 78% coverage: 36:266/297 of query aligns to 5:232/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
27% identity, 78% coverage: 36:266/297 of query aligns to 5:232/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
27% identity, 78% coverage: 36:266/297 of query aligns to 5:232/238 of 1lagE
>RR42_RS07775 FitnessBrowser__Cup4G11:RR42_RS07775
MKSIPVVATMLIAAGLPLGASDLYAQTLEKIASSDTITVSYREAAVPFSYLLAPHKAVGF
SVDLTEAIVDEVRARLKKPHLKVDYVPVTGQNRIPMLVSGTYDLECGSTTNTSARGKEVA
FSINVFYAGTRLLTKKSSGIKNYSDLTKKTVASTAGSTNEKLLNKFSADHNLDIQFVSGK
DYADAMQLVLNDRAVALALDDVLLFGLRANSGNPSALEIVGDTLQVEPYACMVRKDDTEF
KKLVDGTITRLMKSGEFARLYKKWFESPIPPAGANLNMPMSDALRANIKARSDKPAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory