Comparing RR42_RS07805 FitnessBrowser__Cup4G11:RR42_RS07805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 88% coverage: 27:247/251 of query aligns to 6:222/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 88% coverage: 27:247/251 of query aligns to 6:224/226 of 4zv1A
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
34% identity, 86% coverage: 31:247/251 of query aligns to 8:220/226 of 8eyzA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
32% identity, 88% coverage: 27:247/251 of query aligns to 19:233/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
32% identity, 88% coverage: 27:247/251 of query aligns to 19:233/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
32% identity, 88% coverage: 27:247/251 of query aligns to 19:233/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
32% identity, 88% coverage: 27:247/251 of query aligns to 15:229/237 of 3vv5A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 88% coverage: 26:247/251 of query aligns to 11:227/229 of 5t0wA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
32% identity, 88% coverage: 26:247/251 of query aligns to 2:221/224 of 4ymxA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
30% identity, 88% coverage: 26:247/251 of query aligns to 7:226/228 of 2y7iA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
30% identity, 87% coverage: 29:247/251 of query aligns to 14:226/229 of 6svfA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
30% identity, 89% coverage: 27:249/251 of query aligns to 6:227/234 of 3k4uE
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
30% identity, 88% coverage: 27:247/251 of query aligns to 4:224/225 of 3tqlA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
28% identity, 86% coverage: 29:245/251 of query aligns to 12:228/237 of 4i62A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
27% identity, 87% coverage: 29:247/251 of query aligns to 18:233/235 of 4g4pA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
28% identity, 88% coverage: 27:247/251 of query aligns to 28:252/260 of P0AEU0
Sites not aligning to the query:
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 88% coverage: 27:247/251 of query aligns to 28:252/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
28% identity, 88% coverage: 27:247/251 of query aligns to 6:230/238 of 1hslA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
26% identity, 87% coverage: 29:247/251 of query aligns to 5:219/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
26% identity, 87% coverage: 29:247/251 of query aligns to 9:223/235 of 2pvuA
>RR42_RS07805 FitnessBrowser__Cup4G11:RR42_RS07805
MLKIALKSLAAALSFALVSAYAQQPVIKIGATPTAVPFNFLNVKTNALEGVMIDVARAVS
KELGVTPEISGIPFATLIPSLQTRKIDMISSAFAKTPARAVAVDFSETVLTYKEALLVPI
NDTKAYRNYDDLKGKVVGVQMGTSYVEPLKAVQGFKELKMYDTMADLVRDIGLGRVDAGF
GDGPVVAYQVRTSASKQVRLVDTYQSLLATDIALAVRKGDTEMLARVNAAVAKIKQNGEL
ADILKKWGVPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory