Comparing RR42_RS07840 FitnessBrowser__Cup4G11:RR42_RS07840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
35% identity, 90% coverage: 34:395/401 of query aligns to 27:374/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
27% identity, 95% coverage: 17:396/401 of query aligns to 7:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
27% identity, 95% coverage: 17:396/401 of query aligns to 8:358/360 of 2f7vA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 75% coverage: 84:383/401 of query aligns to 72:366/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
31% identity, 57% coverage: 62:290/401 of query aligns to 46:273/377 of 7t1qA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 86% coverage: 55:398/401 of query aligns to 43:378/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 86% coverage: 55:398/401 of query aligns to 39:374/377 of P44514
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
31% identity, 53% coverage: 62:275/401 of query aligns to 46:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
31% identity, 53% coverage: 62:275/401 of query aligns to 46:258/375 of 4pqaA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 83% coverage: 54:384/401 of query aligns to 74:406/426 of 3pfoA
7lgpB Dape enzyme from shigella flexneri
31% identity, 52% coverage: 82:289/401 of query aligns to 63:273/377 of 7lgpB
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
28% identity, 56% coverage: 69:292/401 of query aligns to 60:293/408 of Q03154
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 74% coverage: 69:366/401 of query aligns to 60:363/407 of P37111
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
35% identity, 32% coverage: 55:184/401 of query aligns to 41:170/258 of 4h2kA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 85% coverage: 43:384/401 of query aligns to 32:356/373 of 3rzaA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
39% identity, 25% coverage: 82:182/401 of query aligns to 62:166/265 of 4op4B
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
39% identity, 22% coverage: 76:162/401 of query aligns to 76:164/468 of 1lfwA
Sites not aligning to the query:
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
39% identity, 22% coverage: 76:162/401 of query aligns to 76:164/470 of P45494
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
39% identity, 16% coverage: 82:147/401 of query aligns to 86:152/458 of 2pokA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
31% identity, 32% coverage: 83:211/401 of query aligns to 121:264/503 of Q8C165
Sites not aligning to the query:
>RR42_RS07840 FitnessBrowser__Cup4G11:RR42_RS07840
MQADTLSKPADAATRGSALDWTQRLVSYDTTSRHSNLGLIEAVRDHFLAKGLRPHLSYNP
QGDKANLFVTVPAASGSTDGGIVLSGHTDVVPVDGQNWTTDPFKPVIRDGRLYGRGTCDM
KGFIGTSLALLPTLLEARLREPVHYALSFDEEIGCMGAPYLLAELRERGVTPGGCIVGEP
TSMRVIVAHKGINAYRCCVKGQAAHSSLTPKGVNAIEYAARLICHIRDIADEFKANGPYD
RDFDVPFTTAQTGTIHGGIALNTIPALCEFVFEFRNLPGVDPEAIFARIQGYANDVLLPK
MRAEHADAGLTINKIAAAPSLDVAEQAAITQLVRALTADRDVNKVAYGTEAGLFQRAGIP
AVVCGPGDIEQAHKPDEFVALDQLAACEAFLHKVVDSLRVN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory