SitesBLAST
Comparing RR42_RS07875 FitnessBrowser__Cup4G11:RR42_RS07875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
A1Z8N1 Facilitated trehalose transporter Tret1-1; DmTret1-1 from Drosophila melanogaster (Fruit fly) (see paper)
26% identity, 55% coverage: 77:316/433 of query aligns to 461:715/857 of A1Z8N1
Sites not aligning to the query:
- 248 modified: Phosphoserine
- 249 modified: Phosphoserine
- 250 modified: Phosphoserine
- 320 modified: Phosphoserine
- 322 modified: Phosphoserine
- 845 modified: Phosphoserine
- 846 modified: Phosphoserine
5eqiA Human glut1 in complex with cytochalasin b (see paper)
24% identity, 43% coverage: 54:238/433 of query aligns to 59:251/447 of 5eqiA
Sites not aligning to the query:
5eqhA Human glut1 in complex with inhibitor (2~{s})-3-(2-bromophenyl)-2-[2- (4-methoxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
24% identity, 43% coverage: 54:238/433 of query aligns to 59:251/447 of 5eqhA
Sites not aligning to the query:
5eqgA Human glut1 in complex with inhibitor (2~{s})-3-(4-fluorophenyl)-2-[2- (3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
24% identity, 43% coverage: 54:238/433 of query aligns to 59:251/447 of 5eqgA
Sites not aligning to the query:
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
24% identity, 43% coverage: 54:238/433 of query aligns to 67:259/492 of P11166
- M77 (≠ L64) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G81) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R121) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G125) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ L132) binding
- P149 (≠ K144) to A: in EIG12; uncertain significance
- R153 (≠ K148) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (≠ I164) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (vs. gap) mutation to C: Strongly decreases glucose transport.
- L204 (≠ V198) mutation to C: Abolishes glucose transport.
- P205 (= P199) mutation to C: Abolishes glucose transport.
- R212 (vs. gap) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (= R206) to S: in EIG12; decreased glucose transport
- R223 (≠ T211) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ F214) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (= R220) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (≠ S222) to V: in EIG12; decreased glucose transport
Sites not aligning to the query:
- 34 N → S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→T: Loss of glycosylation site.
- 51 R → H: in EIG12; uncertain significance; dbSNP:rs201815571
- 60 T → M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- 275 A → T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- 282 binding
- 282:285 natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- 286 G → D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- 295 T → M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- 303 V → L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- 314 G → S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- 324 S → L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- 329 E → Q: in GLUT1DS1; stabilizes the inward-open conformation
- 333 R → Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; R → W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- 340 G→C: Strongly decreases glucose transport.
- 388 binding
- 411 Not glycosylated; binding ; N → S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- 435 natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- 458 R → W: in EIG12; decreased glucose transport; dbSNP:rs13306758
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
24% identity, 41% coverage: 54:232/433 of query aligns to 67:243/492 of P17809
Sites not aligning to the query:
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
24% identity, 41% coverage: 54:232/433 of query aligns to 65:241/493 of P32037
Sites not aligning to the query:
- 43 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 85% coverage: 1:369/433 of query aligns to 1:411/491 of P0AGF4
- F24 (≠ E24) mutation to A: Decreases xylose transport.
- G83 (= G81) mutation to A: Abolishes xylose transport.
- R133 (= R121) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E141) mutation to A: Abolishes xylose transport.
- R160 (≠ K148) mutation to A: Abolishes xylose transport.
- Q168 (= Q160) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ T247) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ TT 247:248) binding
- Q289 (≠ T248) mutation to A: Strongly decreases xylose transport.
- N294 (≠ Y252) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ A256) mutation to A: Abolishes xylose transport.
- N325 (= N284) mutation to A: No effect on xylose transport.
- G340 (= G299) mutation to A: Abolishes xylose transport.
- R341 (= R300) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ V350) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E355) mutation to A: Abolishes xylose transport.
- R404 (= R362) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 70% coverage: 68:369/433 of query aligns to 62:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 70% coverage: 68:369/433 of query aligns to 62:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 70% coverage: 68:369/433 of query aligns to 62:407/475 of 4gbyA
P43427 Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5 from Rattus norvegicus (Rat) (see paper)
30% identity, 34% coverage: 51:199/433 of query aligns to 71:201/502 of P43427
- Q166 (≠ S156) binding ; mutation to E: Impairs D-fructose binding.
Sites not aligning to the query:
- 31 binding
- 287 binding
- 295:297 binding
- 386 binding
- 418:419 binding
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 47% coverage: 24:225/433 of query aligns to 54:234/444 of Q8NLB7
- D54 (≠ E24) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D27) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ H79) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
A0A0J9SZQ5 Hexose transporter 1; PvHT; Facilitative hexose transporter from Plasmodium vivax (strain Brazil I) (see paper)
23% identity, 61% coverage: 57:319/433 of query aligns to 71:347/502 of A0A0J9SZQ5
- Q167 (≠ S156) mutation to N: Reduces D-fructose transport with no significant effect on D-glucose uptake. Reduces susceptibility to inhibition by compound 3361.
Q3T9X0 Solute carrier family 2, facilitated glucose transporter member 9; Glucose transporter type 9; GLUT-9; Urate transporter from Mus musculus (Mouse) (see paper)
24% identity, 58% coverage: 54:305/433 of query aligns to 93:366/538 of Q3T9X0
Sites not aligning to the query:
- 71 N→Q: Decreased N-glycosylation.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 36% coverage: 68:225/433 of query aligns to 98:262/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Query Sequence
>RR42_RS07875 FitnessBrowser__Cup4G11:RR42_RS07875
MSSSPSQQHGFRTVFRVVSGNFLEMYDFMVYGFYAAAIAKTFFPSGNEFASLMLSLATFG
AGFLMRPLGAIILGAYIDHHGRRKGLIMTLVLMALGTLLIACVPGYASIGVAAPLLVLAG
RLLQGFSAGVELGGVSVYLAEIAKPGKKGFYVAWQSASQQVAVIFAGLLGVVLHSMLSPE
EMGEWGWRIPFLIGCLIVPFLFLIRRSLEETEEFKTRKHRPSISEIYRSMMENWRIIVAG
CMMVVMTTVSFYMITAYTPTFGKTVLKLDDVDNLIVTMCVGLSNFIWLPLMGALSDRVGR
KPLLVIFTILTLLTAYPAVSWLVAEPSFGRLLMVELWLSFLYGSYNGAMVVTLTEVMPPA
VRTAGFSLAYSLATALFGGFTPAISTYLIHSTGNKAAPGLWLMFAAACGLIATLVIFRGG
RQHAYVEPAAKTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory