SitesBLAST
Comparing RR42_RS09465 FitnessBrowser__Cup4G11:RR42_RS09465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
43% identity, 79% coverage: 61:316/325 of query aligns to 62:319/334 of 5aovA
- active site: L100 (= L99), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H285)
- binding glyoxylic acid: Y74 (≠ I73), A75 (≠ S74), V76 (= V75), G77 (= G76), R241 (= R237), H288 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V75), T104 (= T103), F158 (= F153), G159 (= G154), R160 (= R155), I161 (= I156), S180 (≠ N176), R181 (≠ E177), A211 (≠ T207), V212 (≠ L208), P213 (= P209), T218 (= T214), I239 (≠ G235), A240 (= A236), R241 (= R237), H288 (= H285), G290 (= G287)
Sites not aligning to the query:
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
39% identity, 98% coverage: 4:320/325 of query aligns to 4:324/324 of 2gcgA
- active site: L103 (= L99), R241 (= R237), D265 (= D261), E270 (= E266), H289 (= H285)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (vs. gap), S78 (= S74), V79 (= V75), G80 (= G76), R241 (= R237), H289 (= H285)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V75), T107 (= T103), G156 (= G152), G158 (= G154), I160 (= I156), G180 (≠ N176), R181 (vs. gap), R184 (vs. gap), C212 (≠ L208), S213 (≠ P209), T218 (= T214), I239 (≠ G235), R241 (= R237), D265 (= D261), H289 (= H285), G291 (= G287)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
39% identity, 98% coverage: 4:320/325 of query aligns to 8:328/328 of Q9UBQ7
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
43% identity, 78% coverage: 64:316/325 of query aligns to 64:318/332 of 6biiA
- active site: L99 (= L99), R240 (= R237), D264 (= D261), E269 (= E266), H287 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V75), T103 (= T103), G156 (= G152), F157 (= F153), G158 (= G154), R159 (= R155), I160 (= I156), A179 (≠ N176), R180 (≠ E177), S181 (≠ T178), K183 (≠ A180), V211 (≠ L208), P212 (= P209), E216 (≠ S213), T217 (= T214), V238 (≠ G235), A239 (= A236), R240 (= R237), D264 (= D261), H287 (= H285), G289 (= G287)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
36% identity, 97% coverage: 1:316/325 of query aligns to 1:319/333 of 2dbqA
- active site: L100 (= L99), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V75), T104 (= T103), L158 (≠ F153), G159 (= G154), R160 (= R155), I161 (= I156), S180 (≠ N176), R181 (≠ E177), T182 (= T178), A211 (≠ T207), V212 (≠ L208), P213 (= P209), T218 (= T214), I239 (≠ G235), A240 (= A236), R241 (= R237), D265 (= D261), H288 (= H285), G290 (= G287)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
36% identity, 97% coverage: 1:316/325 of query aligns to 1:319/334 of O58320
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
36% identity, 88% coverage: 32:316/325 of query aligns to 30:308/311 of 3bazA
- active site: L98 (= L99), R230 (= R237), A251 (= A258), D254 (= D261), E259 (= E266), H277 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V75), G149 (= G152), L150 (≠ F153), G151 (= G154), R152 (= R155), I153 (= I156), S172 (≠ N176), R173 (≠ E177), S174 (≠ T178), C201 (≠ L208), P202 (= P209), T207 (= T214), I228 (≠ G235), G229 (≠ A236), R230 (= R237), D254 (= D261), H277 (= H285), G279 (= G287)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
36% identity, 88% coverage: 32:316/325 of query aligns to 32:310/313 of Q65CJ7
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
40% identity, 86% coverage: 34:312/325 of query aligns to 31:305/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 86% coverage: 34:312/325 of query aligns to 30:304/526 of 3dc2A
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 86% coverage: 31:311/325 of query aligns to 29:305/305 of 6plfA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 87% coverage: 31:312/325 of query aligns to 33:310/533 of O43175
- T78 (≠ V75) binding
- R135 (≠ A132) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 155:156) binding
- D175 (≠ N176) binding
- T207 (≠ L208) binding
- CAR 234:236 (≠ GAR 235:237) binding
- D260 (= D261) binding
- V261 (= V262) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGS 285:288) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 25:297/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (≠ V175), D167 (≠ N176), P168 (≠ E177), I169 (≠ T178), I170 (≠ A179), H198 (≠ T207), T199 (≠ L208), L208 (= L217), R228 (= R237)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 28:300/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 28:300/301 of 6rj5A
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 29:301/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V75), A102 (≠ T103), G148 (= G152), R151 (= R155), I152 (= I156), Y170 (≠ V175), D171 (≠ N176), P172 (≠ E177), I173 (≠ T178), H202 (≠ T207), T203 (≠ L208), P204 (= P209), T209 (= T214), C230 (≠ G235), A231 (= A236), R232 (= R237), H279 (= H285), G281 (= G287)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (= E299)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 28:300/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L151), G147 (= G152), L148 (≠ F153), G149 (= G154), R150 (= R155), I151 (= I156), G152 (= G157), D170 (≠ N176), H201 (≠ T207), T202 (≠ L208), P203 (= P209)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 28:300/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 85% coverage: 31:307/325 of query aligns to 27:299/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L99), A100 (≠ T103), R149 (= R155), I150 (= I156), Y168 (≠ V175), D169 (≠ N176), P170 (≠ E177), I171 (≠ T178), H200 (≠ T207), T201 (≠ L208), P202 (= P209), T207 (= T214), C228 (≠ G235), A229 (= A236), R230 (= R237), H277 (= H285), G279 (= G287)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 84% coverage: 31:303/325 of query aligns to 27:296/297 of 6rj3A
Query Sequence
>RR42_RS09465 FitnessBrowser__Cup4G11:RR42_RS09465
MRKNVLVFRPIPPDLLARIEAEHDVIVADPRQPPQRPAFRAALANAHGLIGSSVKLGAAE
LAEAGRLEVISSISVGVDNYDLACLRRRGITLCHTPGVLTETTADTVFALIMAASRRLVE
LAAHVREGRWAANIGESLFGWDVHGKTLAILGFGRIGQAVARRAALGFGMEVLYVNETAA
EPPDLVGRATRTELDDALRRADIVAVTLPLTKSTRGLMGQREFALMKPGAIFVNGARGQI
VQEDALLAALDSGHLRAAGLDVFATEPLPQDSPLRCHARVTALPHIGSATHETRRAMAEL
ATRNLLDALAGRPPATRFDLTAMAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory