Comparing RR42_RS09470 FitnessBrowser__Cup4G11:RR42_RS09470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 96% coverage: 5:305/314 of query aligns to 2:300/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
29% identity, 96% coverage: 5:305/314 of query aligns to 1:299/311 of 2varA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
37% identity, 96% coverage: 5:304/314 of query aligns to 2:292/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
37% identity, 96% coverage: 5:304/314 of query aligns to 2:292/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
37% identity, 96% coverage: 5:304/314 of query aligns to 2:292/301 of 1v1aA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
30% identity, 95% coverage: 7:305/314 of query aligns to 3:297/308 of 2dcnA
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 94% coverage: 7:302/314 of query aligns to 4:294/308 of 3iq0B
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 91% coverage: 26:311/314 of query aligns to 17:303/306 of 5eynA
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
28% identity, 97% coverage: 4:309/314 of query aligns to 1:304/312 of 3in1A
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
29% identity, 91% coverage: 26:311/314 of query aligns to 21:307/310 of 5yggA
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 86% coverage: 7:276/314 of query aligns to 2:254/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 86% coverage: 7:276/314 of query aligns to 3:255/304 of 3ih0A
Sites not aligning to the query:
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
31% identity, 87% coverage: 5:277/314 of query aligns to 15:276/294 of 4eumA
Sites not aligning to the query:
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
31% identity, 87% coverage: 5:277/314 of query aligns to 15:280/306 of 4ebuA
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
30% identity, 85% coverage: 8:273/314 of query aligns to 5:240/282 of 7fcaD
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 95% coverage: 7:304/314 of query aligns to 7:298/319 of Q8ZKR2
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 95% coverage: 7:304/314 of query aligns to 3:287/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
26% identity, 95% coverage: 7:304/314 of query aligns to 3:287/297 of 1tz6A
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
27% identity, 87% coverage: 5:276/314 of query aligns to 6:291/329 of 2afbA
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 88% coverage: 29:304/314 of query aligns to 29:289/300 of 8cqxA
>RR42_RS09470 FitnessBrowser__Cup4G11:RR42_RS09470
MSPDLDVVTLGEAMLMLVAGEAGPLEGVQTFHKRTAGAETNVAIGLSRLGLKVGWASRLG
DDSMARYLLGEMRREGVDCSQVVCEPGERTGFQFKGRVDDGSDPPVEYHRRGSAASRMNP
EHLDDRWLRRARHLHVTGVFPALAEGTQAATRQAIATMRAAGRTVSFDPNLRPALWATPE
LMRETLNNLAQQCDWVLPGIEEGRFLTGHAEPERIAAFYRGRGARLVVVKLGAEGAYFDG
EAGTGHVPAFSVERVVDTVGAGDGFAVGVISALLQGRTVADAVRRGAWIGARAVQVRGDT
EGLPTHALLAASNL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory