Comparing RR42_RS09480 FitnessBrowser__Cup4G11:RR42_RS09480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
51% identity, 97% coverage: 2:238/244 of query aligns to 1:236/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
54% identity, 95% coverage: 9:239/244 of query aligns to 7:237/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
52% identity, 98% coverage: 1:239/244 of query aligns to 1:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
52% identity, 98% coverage: 1:239/244 of query aligns to 1:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
52% identity, 98% coverage: 1:239/244 of query aligns to 1:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
52% identity, 98% coverage: 1:239/244 of query aligns to 1:239/242 of 2oljA
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
50% identity, 97% coverage: 9:244/244 of query aligns to 8:254/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
50% identity, 97% coverage: 9:244/244 of query aligns to 12:258/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 95% coverage: 10:240/244 of query aligns to 12:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 95% coverage: 10:240/244 of query aligns to 13:244/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 95% coverage: 10:240/244 of query aligns to 13:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 95% coverage: 10:240/244 of query aligns to 13:244/344 of 3tuiC
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
39% identity, 89% coverage: 1:216/244 of query aligns to 1:217/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
39% identity, 88% coverage: 3:216/244 of query aligns to 3:217/229 of 6z67B
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
37% identity, 88% coverage: 3:217/244 of query aligns to 1:216/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
37% identity, 88% coverage: 3:217/244 of query aligns to 1:216/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
37% identity, 88% coverage: 3:217/244 of query aligns to 1:216/218 of 8hd0A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 94% coverage: 2:231/244 of query aligns to 16:241/378 of P69874
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 91% coverage: 2:222/244 of query aligns to 3:227/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 88% coverage: 3:216/244 of query aligns to 3:216/223 of 2pclA
>RR42_RS09480 FitnessBrowser__Cup4G11:RR42_RS09480
MPIVEAQGVHKSYGPVEVLKGVSFAIEPGQVVAIIGRSGSGKSTMLRCLNGLETINAGNI
TVAGHKLDHDRKRLLDLRRDVGMVFQSYNLFPHLTVGENIALAPAIVKKMATDKIDGIVD
QVLAQVGLQDKKDCYPEQLSGGQQQRVAIARSLAMEPKVMLFDEVTSALDPELTAEVLRV
MENLAASGMTMVLVTHEMEFARRMAHTTIFMHQGKVHEAGPSKALFAQPRTPELQQFLSA
GALK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory