SitesBLAST
Comparing RR42_RS09880 FitnessBrowser__Cup4G11:RR42_RS09880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
45% identity, 100% coverage: 2:501/501 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (vs. gap), N98 (= N61), G99 (= G62), Y248 (= Y143), E481 (= E374), K485 (= K378), E488 (= E381), H504 (= H397), K603 (= K496)
- binding fructose -6-phosphate: G301 (= G193), T302 (= T194), S303 (= S195), S347 (= S239), Q348 (= Q240), S349 (= S241), T352 (= T244), S401 (= S293), K485 (= K378), E488 (= E381)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
45% identity, 100% coverage: 2:501/501 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (vs. gap), N98 (= N61), G99 (= G62), Y248 (= Y143), E481 (= E374), K485 (= K378), E488 (= E381), H504 (= H397), K603 (= K496)
- binding glucose-6-phosphate: T302 (= T194), S303 (= S195), S347 (= S239), Q348 (= Q240), S349 (= S241), T352 (= T244), S401 (= S293), K485 (= K378), E488 (= E381)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
45% identity, 100% coverage: 2:501/501 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (vs. gap), N98 (= N61), G99 (= G62), Y248 (= Y143), E481 (= E374), K485 (= K378), E488 (= E381), H504 (= H397), K603 (= K496)
- binding glucose-6-phosphate: T302 (= T194), S347 (= S239), Q348 (= Q240), S349 (= S241), T352 (= T244), V399 (= V291), S401 (= S293), E488 (= E381)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (vs. gap), W74 (vs. gap), T76 (vs. gap), H86 (= H48), N98 (= N61), G99 (= G62), D123 (vs. gap)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
55% identity, 72% coverage: 141:501/501 of query aligns to 4:366/366 of 1morA
- active site: E239 (= E374), K243 (= K378), E246 (= E381), H262 (= H397), K361 (= K496)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T194), S105 (= S239), Q106 (= Q240), S107 (= S241), T110 (= T244), V157 (= V291), A360 (= A495), K361 (= K496)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
55% identity, 72% coverage: 141:501/501 of query aligns to 4:366/366 of 1moqA
- active site: E239 (= E374), K243 (= K378), E246 (= E381), H262 (= H397), K361 (= K496)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T194), S61 (= S195), S105 (= S239), Q106 (= Q240), S107 (= S241), T110 (= T244), V157 (= V291), A360 (= A495), K361 (= K496)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
55% identity, 72% coverage: 141:501/501 of query aligns to 5:367/367 of 1mosA
- active site: E240 (= E374), K244 (= K378), E247 (= E381), H263 (= H397), K362 (= K496)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T194), S62 (= S195), S106 (= S239), Q107 (= Q240), S108 (= S241), T111 (= T244), K244 (= K378), E247 (= E381)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
54% identity, 70% coverage: 141:492/501 of query aligns to 4:357/357 of 7dnrA
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
39% identity, 84% coverage: 83:501/501 of query aligns to 245:663/663 of 6r4eA
- active site: E536 (= E374), K540 (= K378), E543 (= E381), H559 (= H397), K658 (= K496)
- binding glucose-6-phosphate: T358 (= T194), S359 (= S195), S403 (= S239), Q404 (= Q240), S405 (= S241), T408 (= T244), S456 (= S293), K540 (= K378), E543 (= E381)
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
39% identity, 84% coverage: 83:501/501 of query aligns to 242:660/660 of 6svmA
- active site: E533 (= E374), K537 (= K378), E540 (= E381), H556 (= H397), K655 (= K496)
- binding glucose-6-phosphate: C353 (= C192), T355 (= T194), S356 (= S195), S400 (= S239), Q401 (= Q240), S402 (= S241), T405 (= T244), S453 (= S293), K537 (= K378), E540 (= E381)
- binding magnesium ion: S434 (≠ L274), R435 (= R275), T437 (≠ A277)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ E132), R322 (≠ L165), G334 (≠ A175), G424 (≠ A264), T426 (≠ C266), S434 (≠ L274), T437 (≠ A277), C439 (≠ L279), G440 (≠ H280), V441 (≠ F281), H442 (≠ L282)
Sites not aligning to the query:
- active site: 7, 32, 95, 122, 123
- binding glutamic acid: 1, 94, 95, 97, 107, 123, 147
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
38% identity, 84% coverage: 83:501/501 of query aligns to 276:699/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
38% identity, 82% coverage: 83:494/501 of query aligns to 241:652/652 of 6r4gA
- active site: E532 (= E374), K536 (= K378), E539 (= E381), H555 (= H397)
- binding glucose-6-phosphate: G353 (= G193), T354 (= T194), S355 (= S195), S399 (= S239), Q400 (= Q240), S401 (= S241), T404 (= T244), S452 (= S293), E539 (= E381)
- binding magnesium ion: S433 (≠ L274), R434 (= R275), T436 (≠ A277)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ E132), R321 (≠ L165), G333 (≠ A175), G423 (≠ A264), T425 (≠ C266), S433 (≠ L274), T436 (≠ A277), C438 (≠ L279), G439 (≠ H280), V440 (≠ F281), H441 (≠ L282)
Sites not aligning to the query:
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
41% identity, 72% coverage: 141:501/501 of query aligns to 3:365/365 of 2zj4A
- active site: E238 (= E374), K242 (= K378), E245 (= E381), H261 (= H397), K360 (= K496)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T194), S61 (= S195), S105 (= S239), Q106 (= Q240), S107 (= S241), T110 (= T244), V156 (= V291), A157 (= A292), K242 (= K378), E245 (= E381)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
41% identity, 72% coverage: 141:501/501 of query aligns to 3:365/365 of 2zj3A
- active site: E238 (= E374), K242 (= K378), E245 (= E381), H261 (= H397), K360 (= K496)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T194), S61 (= S195), S105 (= S239), Q106 (= Q240), S107 (= S241), T110 (= T244), V156 (= V291), A359 (= A495), K360 (= K496)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 88% coverage: 63:501/501 of query aligns to 261:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
39% identity, 70% coverage: 141:489/501 of query aligns to 2:352/352 of 2v4mA
- active site: E237 (= E374), K241 (= K378), E244 (= E381), H260 (= H397)
- binding fructose -6-phosphate: T59 (= T194), S60 (= S195), S104 (= S239), Q105 (= Q240), S106 (= S241), T109 (= T244), A156 (= A292), S157 (= S293), K241 (= K378), E244 (= E381)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 69% coverage: 142:489/501 of query aligns to 1:352/352 of 2pocB
- active site: E236 (= E374), K240 (= K378), E243 (= E381), H259 (= H397)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C192), T57 (= T194), S58 (= S195), S102 (= S239), Q103 (= Q240), S104 (= S241), T107 (= T244), E243 (= E381)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ L165), G36 (≠ A175), G126 (≠ A264), V128 (≠ C266), S136 (≠ L274), T139 (≠ A277), C141 (≠ L279), G142 (≠ H280), V143 (≠ F281), H144 (≠ L282)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
36% identity, 69% coverage: 142:489/501 of query aligns to 1:339/339 of 2putA
- active site: E236 (= E374), K240 (= K378), E243 (= E381)
- binding fructose -6-phosphate: C55 (= C192), T57 (= T194), S102 (= S239), Q103 (= Q240), S104 (= S241), T107 (= T244), A154 (= A292), S155 (= S293), K240 (= K378)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ L165), G36 (≠ A175), G126 (≠ A264), V128 (≠ C266), S136 (≠ L274), T139 (≠ A277), C141 (≠ L279), G142 (≠ H280), V143 (≠ F281), H144 (≠ L282)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
36% identity, 70% coverage: 141:489/501 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E374), K241 (= K378), E244 (= E381)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C192), T58 (= T194), S103 (= S239), Q104 (= Q240), S105 (= S241), T108 (= T244), A155 (= A292), E244 (= E381)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (≠ L165), G37 (≠ A175), G127 (≠ A264), V129 (≠ C266), S137 (≠ L274), T140 (≠ A277), C142 (≠ L279), G143 (≠ H280), V144 (≠ F281), H145 (≠ L282)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
35% identity, 69% coverage: 142:489/501 of query aligns to 1:331/331 of 2puwB
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
33% identity, 53% coverage: 187:450/501 of query aligns to 42:296/319 of 8eymA
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: R47 (≠ C192), D51 (≠ Y196), Y59 (= Y204), A71 (≠ V216), A72 (≠ E217), P74 (≠ A219), S75 (= S220), R209 (= R365), S235 (≠ A391), E238 (= E394)
- binding 2-deoxy-2-amino glucitol-6-phosphate: G48 (= G193), S49 (≠ T194), S95 (= S239), Q96 (= Q240), A147 (= A292), A148 (≠ S293), K222 (= K378), E225 (= E381)
Query Sequence
>RR42_RS09880 FitnessBrowser__Cup4G11:RR42_RS09880
MCGIVGAIAQRNVTPVLLEGLRRLEYRGYDSCGVAVLQDGEPLTRNAHPIFSSGEIALVH
NGIIENHESLRETLSALGRDGNYLASDTMALAGNAEHFIYLEEGDLVSLSREGISIADRD
GNPVAREIRELEATKAAVGLGPYRHYMQKEIFEQPSVIADSTEHLVRFAPALFGAHANAV
FAEIDSVLILACGTSYHSGMTAKYWLESISRLPTSVEIASEYRYRDSVPNPRTLVLAISQ
SGETADTLAALKHAQVLGHRHTLAVCNVAGSAILRQAALHFLTRAGAEIGVASTKAFTTQ
LVALFVLAATLAKRRGMLDAHREAAMLGQLHHLPAALNGVLALAPQIIAWAGSLARKENA
LFLGRGIHYPIALEGALKLKEISYIHAEAYAAGELKHGPLALVTEQMPVVTVAPNDALLE
KLKSNLQEVRARGGELYVFSDADSKIRSAPGLHVIRMPEHYGLLSPILHVVPLQLLAYHT
ACARGTDVDKPRDLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory