SitesBLAST
Comparing RR42_RS09905 FitnessBrowser__Cup4G11:RR42_RS09905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
48% identity, 99% coverage: 2:433/437 of query aligns to 4:428/430 of 5ti1H
- active site: D139 (= D137), H146 (= H144), E212 (= E207), E214 (= E209), D246 (= D241), R250 (= R245), Q253 (= Q248), K266 (= K261), T270 (= T265), E377 (= E381)
- binding magnesium ion: D139 (= D137), E212 (= E207), E214 (= E209), D246 (= D241)
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
45% identity, 95% coverage: 20:433/437 of query aligns to 9:417/419 of 1hyoB
- active site: D128 (= D137), H135 (= H144), E201 (= E207), E203 (= E209), D235 (= D241), R239 (= R245), Q242 (= Q248), K255 (= K261), T259 (= T265), E366 (= E381)
- binding acetate ion: Y130 (= Y139), V139 (≠ C148), R144 (≠ G153)
- binding calcium ion: D128 (= D137), E201 (= E207), E203 (= E209), D235 (= D241)
- binding 4-[hydroxy-[methyl-phosphinoyl]]-3-oxo-butanoic acid: D128 (= D137), F129 (= F138), Y130 (= Y139), H135 (= H144), Y161 (= Y167), K255 (= K261), G351 (= G366), T352 (= T367)
- binding magnesium ion: D235 (= D241), W236 (= W242), K255 (= K261), G258 (≠ A264), T259 (= T265)
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
45% identity, 95% coverage: 20:433/437 of query aligns to 7:415/419 of P16930
- N16 (= N29) to I: in TYRSN1; loss of activity; dbSNP:rs121965073
- A35 (= A49) to T: in TYRSN1; atypical mild phenotype
- F62 (≠ A77) to C: in TYRSN1; loss of activity
- A134 (= A145) to D: in TYRSN1; loss of activity; dbSNP:rs121965074
- C193 (= C201) to R: in TYRSN1; loss of activity
- D233 (= D241) to V: in TYRSN1; loss of activity; dbSNP:rs80338897
- W234 (= W242) to G: in TYRSN1; loss of activity; dbSNP:rs1555441595
- Q279 (≠ E289) to R: in TYRSN1; may affect splicing resulting in skipping of exon 8 alone or together with exon 9; lower activity as compared to wild type; dbSNP:rs121965078
- R341 (≠ Q358) to W: does not cause a clinically relevant phenotype; results in lower enzyme activity; dbSNP:rs11555096
- P342 (= P359) to L: in TYRSN1; loss of activity; dbSNP:rs779040832
- R381 (= R398) to G: in TYRSN1; loss of activity; dbSNP:rs121965077
- F405 (= F423) to H: in TYRSN1; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
45% identity, 95% coverage: 20:433/437 of query aligns to 7:415/416 of 2hzyA
- active site: D126 (= D137), H133 (= H144), E199 (= E207), E201 (= E209), D233 (= D241), R237 (= R245), Q240 (= Q248), K253 (= K261), T257 (= T265), E364 (= E381)
- binding calcium ion: G122 (= G133), D123 (= D134)
- binding manganese (ii) ion: D126 (= D137), E199 (= E207), E201 (= E209), D233 (= D241)
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
45% identity, 95% coverage: 20:433/437 of query aligns to 7:415/416 of 1qcoA
- active site: K253 (= K261)
- binding acetoacetic acid: D126 (= D137), F127 (= F138), Y128 (= Y139), H133 (= H144), Y159 (= Y167), E199 (= E207), K253 (= K261), G349 (= G366), T350 (= T367)
- binding calcium ion: D126 (= D137), E199 (= E207), E201 (= E209), D233 (= D241)
- binding fumaric acid: Y128 (= Y139), V137 (≠ C148), R142 (≠ G153), Q240 (= Q248), Y244 (≠ M252)
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
44% identity, 95% coverage: 20:436/437 of query aligns to 7:418/419 of P35505
- D126 (= D137) binding
- E199 (= E207) binding
- E201 (= E209) binding ; mutation to G: Decrease in activity.
- D233 (= D241) binding ; binding
- K253 (= K261) binding
- T257 (= T265) binding
Query Sequence
>RR42_RS09905 FitnessBrowser__Cup4G11:RR42_RS09905
MELNHTHDASRRSWLDSANAAGCDFPLQNLPLSVFRRKGSTEAWRGGVAIGDQIVDLGAL
QSLPGLQDSAAEAVRAAAAPTLNGLLELGPESWRALRHGLYGLLQSGSSLARQVREALVP
QLDAEHAVPVRIGDYTDFYTSLDHAVNCCRQFGIEVNPNFDWLPIAYHGRVSSIDVSGQQ
VYRPAGQYRTDPSSAPVYGPCQRLDYELEVGAVIGIGNARGTPIPLANAQQHIFGLCLLN
DWSARDIQTWEMQPLGPFLAKNFATTLSPWIVTLEALLPYRTGWTRAPERPQPLDYLRSA
DNAAAGAFDIQLEVSILSARRQAQGRPPHKLTRTSFQHQYWTLGQMIAHHTVGGCNLQPG
DLLGSGTVSGPNPWEAGALIELTVSGTHPADIGDGEQRGFLKDGDTVVFRGWCEREDYAR
IGFGVNYATVLPAPGPP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory