Comparing RR42_RS09940 FitnessBrowser__Cup4G11:RR42_RS09940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
42% identity, 89% coverage: 26:305/313 of query aligns to 34:298/299 of 3dr2A
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
41% identity, 95% coverage: 16:312/313 of query aligns to 9:290/290 of 3e5zA
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
27% identity, 81% coverage: 29:281/313 of query aligns to 4:272/306 of 7rizA
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
28% identity, 81% coverage: 29:281/313 of query aligns to 4:259/293 of 7risA
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
27% identity, 81% coverage: 29:281/313 of query aligns to 6:259/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
27% identity, 81% coverage: 29:281/313 of query aligns to 6:259/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
27% identity, 81% coverage: 29:281/313 of query aligns to 6:259/293 of 8djfA
Q9M1B4 Protein STRICTOSIDINE SYNTHASE-LIKE 13; AtSSL13; Protein LESS ADHERENT POLLEN 3; Strictosidine synthase 11; AtSS11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 45% coverage: 109:250/313 of query aligns to 186:314/403 of Q9M1B4
Sites not aligning to the query:
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
25% identity, 78% coverage: 37:281/313 of query aligns to 16:249/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
25% identity, 78% coverage: 37:281/313 of query aligns to 16:249/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
25% identity, 78% coverage: 37:281/313 of query aligns to 16:249/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
25% identity, 78% coverage: 37:281/313 of query aligns to 16:249/297 of 4gn7A
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
26% identity, 77% coverage: 33:272/313 of query aligns to 13:231/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
26% identity, 77% coverage: 33:272/313 of query aligns to 13:231/289 of 7plbB
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
26% identity, 77% coverage: 33:272/313 of query aligns to 13:231/289 of Q9A9Z1
>RR42_RS09940 FitnessBrowser__Cup4G11:RR42_RS09940
MAATRLQEPVVLDERFQDVLQPGQLLERLATGAIWSEGPVWVPRLQSVLWSDIPNNRLLR
WSAAGMEVFRQPAQFTNGHTLDLQGRLVSCEHGRRCISRTEADGKVVILADRYKGKRLNS
PNDVVVRSDGSIWFTDPSYGILSDREGYKADQEQPGRHVYRMDPVTGALEVVADDFVQPN
GLAFSPDESKLYISDTSASHDPDGNHHVRVLDVATNGRPGKRLASGGVFTVISPGLPDGL
RVDRQGRVYITAEDGVHVHAPDGTALGHIAVPEKTGNCTFGSAPGSAARNRLYIAASSSL
YAITLITTGAGHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory