Comparing RR42_RS10060 FitnessBrowser__Cup4G11:RR42_RS10060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
29% identity, 83% coverage: 54:333/339 of query aligns to 487:750/753 of 6laaA
Sites not aligning to the query:
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
29% identity, 87% coverage: 35:328/339 of query aligns to 40:314/322 of P33164
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
29% identity, 87% coverage: 35:328/339 of query aligns to 39:313/321 of 2piaA
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
30% identity, 86% coverage: 35:326/339 of query aligns to 484:755/765 of 6kbhA
Sites not aligning to the query:
7ylrA Structure of a bacteria protein
29% identity, 88% coverage: 35:333/339 of query aligns to 36:324/326 of 7ylrA
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
29% identity, 67% coverage: 7:233/339 of query aligns to 104:334/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
29% identity, 67% coverage: 7:233/339 of query aligns to 103:333/333 of 5ogxA
Sites not aligning to the query:
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
29% identity, 64% coverage: 13:229/339 of query aligns to 149:390/396 of 1gvhA
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 64% coverage: 13:229/339 of query aligns to 149:390/396 of P24232
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
27% identity, 58% coverage: 35:229/339 of query aligns to 34:235/237 of 4eh1A
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
25% identity, 66% coverage: 7:231/339 of query aligns to 111:336/337 of 1krhA
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
27% identity, 65% coverage: 8:229/339 of query aligns to 15:244/250 of 1tvcA
Sites not aligning to the query:
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
25% identity, 53% coverage: 52:229/339 of query aligns to 151:333/334 of 7c3bC
Sites not aligning to the query:
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
25% identity, 53% coverage: 52:229/339 of query aligns to 150:320/321 of 7c3aA
Sites not aligning to the query:
3ab5A Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
39% identity, 20% coverage: 262:330/339 of query aligns to 17:85/97 of 3ab5A
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
36% identity, 20% coverage: 262:330/339 of query aligns to 18:86/97 of 1rfkB
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
36% identity, 20% coverage: 262:330/339 of query aligns to 17:85/97 of 7s3dX
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
37% identity, 21% coverage: 257:327/339 of query aligns to 14:84/99 of P0A3C7
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
37% identity, 21% coverage: 257:327/339 of query aligns to 13:83/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
37% identity, 21% coverage: 257:327/339 of query aligns to 13:83/98 of 1czpA
>RR42_RS10060 FitnessBrowser__Cup4G11:RR42_RS10060
MQFHNLTVAQITWETEDARSYALLVPDALQQSFVYRAGQHLTFRVNVDGKTLLRSYSLSS
SPEAGGLPVVTVKRIPGGRASGWFHAHVDAGTRLEVSAPTGRFVCEDMGAPLFFCAAGSG
ITPVLSMIRSALASTSSAMTLYYANRDAASTIFAAQIAKLSRDHSDRLAVHLHHDDTDGF
PERGKIAALLSAVPHCQLYLCGPGPFMQTVLEAAEVAGMGPGCVHLERFDAAAQEPEVAS
AAPMPAQACDATVTLGGALHVVRVASGQSLLQAALACGVDAPYACEEGYCGSCAAKCVDG
AVVHARNDVFSADELAAGWILTCQARPRQERPVAITFDV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory