Comparing RR42_RS10600 FitnessBrowser__Cup4G11:RR42_RS10600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 86% coverage: 48:342/343 of query aligns to 14:303/303 of 4pddA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
31% identity, 76% coverage: 66:324/343 of query aligns to 60:313/328 of Q0B2F6
Sites not aligning to the query:
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
31% identity, 76% coverage: 66:324/343 of query aligns to 34:287/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
31% identity, 76% coverage: 66:324/343 of query aligns to 34:287/301 of 4n15A
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
31% identity, 78% coverage: 31:298/343 of query aligns to 2:266/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
31% identity, 78% coverage: 31:298/343 of query aligns to 3:267/304 of 4pakA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
35% identity, 63% coverage: 59:273/343 of query aligns to 25:238/300 of 4n8yA
Sites not aligning to the query:
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
30% identity, 76% coverage: 40:298/343 of query aligns to 7:264/301 of 4pdhA
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
30% identity, 75% coverage: 42:299/343 of query aligns to 12:267/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
30% identity, 75% coverage: 42:299/343 of query aligns to 12:267/300 of 4pc9A
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
30% identity, 75% coverage: 42:299/343 of query aligns to 36:291/325 of Q16BC9
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
29% identity, 72% coverage: 54:299/343 of query aligns to 26:271/312 of 4oanA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
30% identity, 66% coverage: 68:294/343 of query aligns to 37:273/304 of 4x8rA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
28% identity, 72% coverage: 54:300/343 of query aligns to 20:266/306 of 4xfeA
Sites not aligning to the query:
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
29% identity, 75% coverage: 41:298/343 of query aligns to 8:265/305 of 4mnpA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
32% identity, 75% coverage: 17:273/343 of query aligns to 11:260/329 of P44542
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
32% identity, 71% coverage: 31:273/343 of query aligns to 1:237/310 of 3b50A
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
32% identity, 71% coverage: 31:273/343 of query aligns to 1:237/309 of 2v4cA
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
32% identity, 70% coverage: 35:273/343 of query aligns to 4:236/305 of 2cexB
Sites not aligning to the query:
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
28% identity, 83% coverage: 32:314/343 of query aligns to 5:284/310 of 7bbrA
>RR42_RS10600 FitnessBrowser__Cup4G11:RR42_RS10600
MHPLSRRQFLLSASTITAGAVGFPSVLRAQAPITLRFSSSMLADQNAAHYVWYQRFAANL
KANVGDSIRVDYFPNNQLGKESDVVQQVKVGSIDMMVTGSSIWATIAPELGMLDLGYLFD
SYNHVARVLDGAAGASLNQLLRKRSDCTILTWASHFGARSVYTKRAVKSLADIRGVKLRV
LPTPSFIETFKLMGAIPTPIPFGELYMAAQTGVVDGFEHDAATVLASKLNEVVKFCWLSE
HLFSPMVVVIGRRGMDKIPASLRPAFLKAVADATAQERVIAQSNGSVVVQELKRKGVTFF
PMAPAERVAVRKQMENTLWAGFAKQYPATAPLFSAINAARGES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory