SitesBLAST
Comparing RR42_RS10615 FitnessBrowser__Cup4G11:RR42_RS10615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 83% coverage: 36:319/341 of query aligns to 32:318/533 of O43175
- T78 (≠ V82) binding
- R135 (≠ P138) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ QI 158:159) binding
- D175 (vs. gap) binding
- T207 (≠ A207) binding
- CAR 234:236 (≠ ASR 234:236) binding
- D260 (= D260) binding
- V261 (= V261) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGG 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 82% coverage: 40:318/341 of query aligns to 86:378/466 of P87228
- S87 (= S41) modified: Phosphoserine
- S258 (≠ N210) modified: Phosphoserine
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
32% identity, 81% coverage: 36:310/341 of query aligns to 28:305/305 of 6plfA
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
30% identity, 81% coverage: 44:318/341 of query aligns to 38:322/334 of 5aovA
- active site: L100 (≠ F106), R241 (= R236), D265 (= D260), E270 (≠ M268), H288 (= H284)
- binding glyoxylic acid: M52 (≠ Y58), L53 (≠ R59), L53 (≠ R59), Y74 (≠ C80), A75 (= A81), V76 (= V82), G77 (≠ D83), R241 (= R236), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V82), T104 (≠ V110), F158 (≠ Y156), G159 (= G157), R160 (≠ Q158), I161 (= I159), S180 (vs. gap), R181 (vs. gap), A211 (≠ V206), V212 (≠ A207), P213 (= P208), T218 (= T213), I239 (≠ A234), A240 (≠ S235), R241 (= R236), H288 (= H284), G290 (= G286)
7dkmA Phgdh covalently linked to oridonin (see paper)
31% identity, 80% coverage: 36:309/341 of query aligns to 28:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V82), A102 (≠ V110), G148 (= G155), R151 (≠ Q158), I152 (= I159), Y170 (vs. gap), D171 (vs. gap), P172 (vs. gap), I173 (≠ V176), H202 (≠ V206), T203 (≠ A207), P204 (= P208), T209 (= T213), C230 (≠ A234), A231 (≠ S235), R232 (= R236), H279 (= H284), G281 (= G286)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ L298)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
31% identity, 80% coverage: 36:309/341 of query aligns to 27:303/303 of 6plgA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
32% identity, 80% coverage: 36:308/341 of query aligns to 27:302/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I154), G147 (= G155), L148 (≠ Y156), G149 (= G157), R150 (≠ Q158), I151 (= I159), G152 (= G160), D170 (vs. gap), H201 (≠ V206), T202 (≠ A207), P203 (= P208)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
32% identity, 80% coverage: 36:308/341 of query aligns to 27:302/302 of 6rihA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
32% identity, 80% coverage: 36:308/341 of query aligns to 24:299/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G157), I148 (= I159), Y166 (vs. gap), D167 (vs. gap), P168 (vs. gap), I169 (≠ V176), I170 (≠ T177), H198 (≠ V206), T199 (≠ A207), L208 (≠ M216), R228 (= R236)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
32% identity, 75% coverage: 36:292/341 of query aligns to 26:285/297 of 6rj3A
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
32% identity, 75% coverage: 36:292/341 of query aligns to 27:286/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
32% identity, 75% coverage: 36:292/341 of query aligns to 26:285/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ F106), A100 (≠ V110), R149 (≠ Q158), I150 (= I159), Y168 (vs. gap), D169 (vs. gap), P170 (vs. gap), I171 (≠ V176), H200 (≠ V206), T201 (≠ A207), P202 (= P208), T207 (= T213), C228 (≠ A234), A229 (≠ S235), R230 (= R236), H277 (= H284), G279 (= G286)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
39% identity, 69% coverage: 71:304/341 of query aligns to 72:308/406 of 2p9eA
- active site: N104 (≠ F106), R236 (= R236), D260 (= D260), E265 (≠ G262), H288 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G157), H157 (≠ Q158), I158 (= I159), Y176 (≠ V176), D177 (≠ T177), I178 (≠ T178), H206 (≠ V206), V207 (≠ A207), P208 (= P208), S212 (≠ E212), A234 (= A234), S235 (= S235), R236 (= R236), H288 (= H284), G290 (= G286)
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
38% identity, 67% coverage: 78:304/341 of query aligns to 75:308/406 of 1ybaA
- active site: N104 (≠ F106), R236 (= R236), D260 (= D260), E265 (≠ G262), H288 (= H284)
- binding 2-oxoglutaric acid: C79 (≠ A81), I80 (≠ V82)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ V82), F102 (≠ A104), V108 (= V110), G154 (= G155), G156 (= G157), H157 (≠ Q158), I158 (= I159), Y176 (≠ V176), D177 (≠ T177), I178 (≠ T178), K181 (= K181), H206 (≠ V206), V207 (≠ A207), P208 (= P208), A234 (= A234), S235 (= S235), R236 (= R236), H288 (= H284), G290 (= G286)
- binding phosphate ion: G81 (≠ D83), N83 (≠ S85)
Sites not aligning to the query:
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
38% identity, 67% coverage: 78:304/341 of query aligns to 73:306/404 of 1psdA
- active site: N102 (≠ F106), R234 (= R236), D258 (= D260), E263 (≠ G262), H286 (= H284)
- binding nicotinamide-adenine-dinucleotide: N102 (≠ F106), H155 (≠ Q158), I156 (= I159), D175 (≠ T177), I176 (≠ T178), K179 (= K181), H204 (≠ V206), V205 (≠ A207), P206 (= P208), A232 (= A234), S233 (= S235), R234 (= R236), H286 (= H284)
Sites not aligning to the query:
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 67% coverage: 78:304/341 of query aligns to 79:312/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
31% identity, 80% coverage: 45:318/341 of query aligns to 38:321/332 of 6biiA
- active site: L99 (≠ F106), R240 (= R236), D264 (= D260), E269 (≠ M268), H287 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V82), T103 (≠ V110), G156 (= G155), F157 (≠ Y156), G158 (= G157), R159 (≠ Q158), I160 (= I159), A179 (≠ T178), R180 (≠ P179), S181 (≠ G180), K183 (≠ I182), V211 (≠ A207), P212 (= P208), E216 (= E212), T217 (= T213), V238 (≠ A234), A239 (≠ S235), R240 (= R236), D264 (= D260), H287 (= H284), G289 (= G286)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
28% identity, 91% coverage: 1:312/341 of query aligns to 1:322/334 of 3kb6B
- active site: S97 (≠ F106), R231 (= R236), D255 (= D260), E260 (vs. gap), H294 (= H284)
- binding lactic acid: F49 (≠ I56), S72 (≠ A81), V73 (= V82), G74 (≠ D83), Y96 (≠ G105), R231 (= R236), H294 (= H284)
- binding nicotinamide-adenine-dinucleotide: V73 (= V82), Y96 (≠ G105), V101 (= V110), G150 (= G157), R151 (≠ Q158), I152 (= I159), D171 (≠ T178), V172 (≠ I182), P203 (= P208), T229 (≠ A234), A230 (≠ S235), R231 (= R236), H294 (= H284), A296 (≠ G286), Y297 (≠ G287)
1sc6D Crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with NAD+ (see paper)
38% identity, 69% coverage: 71:304/341 of query aligns to 70:286/384 of 1sc6D
- active site: N102 (≠ F106), R228 (= R236), D252 (= D260)
- binding nicotinamide-adenine-dinucleotide: P99 (≠ S103), F100 (≠ A104), N102 (≠ F106), T103 (≠ M107), G146 (= G155), G148 (= G157), H149 (≠ Q158), I150 (= I159), Y168 (≠ V176), D169 (≠ T177), I170 (≠ T178), H198 (≠ V206), V199 (≠ A207), P200 (= P208), S204 (≠ E212), T205 (= T213), S227 (= S235)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
31% identity, 76% coverage: 45:304/341 of query aligns to 31:289/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ Q158), Y160 (vs. gap), D161 (vs. gap), P162 (vs. gap), I164 (≠ T177), L179 (= L193), T193 (≠ A207), P194 (= P208), S198 (≠ E212), L202 (≠ M216)
Query Sequence
>RR42_RS10615 FitnessBrowser__Cup4G11:RR42_RS10615
MKTVFVSHPTDKLRHYFGNQAITALQAFAEVRLNTEARELSTPELIAAAHGCDALIAYRQ
TPGPEALFAGLPALAAFIRCAVDISTIDVPAASRHGVLITQASAGFMPAVSEWAIGAMVD
LARGTSRYAAAYHRGQPPAPVMGRELRGSVLGVIGYGQIGRYLCELAQAFGMRILVTTPG
KIPAQPALRQVPLPQLLAEADFVVCVAPANAETENMMNAQAFAAMKPDAYFINASRGELV
DEPALLHALESGHLGGCALDVGRAPDQMPVLGLARHPNVIATPHIGGLTLAATEHQALET
VEQLRALVQGRLPDGAVNAARATRLQRWGIHLTGLENAEAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory