SitesBLAST
Comparing RR42_RS10625 FitnessBrowser__Cup4G11:RR42_RS10625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
73% identity, 97% coverage: 14:452/452 of query aligns to 7:446/446 of P0AES2
- Y150 (= Y157) mutation to F: Reduces activity 100-fold.
- K207 (= K214) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D242) binding
- E266 (≠ Q273) binding
- N289 (= N296) binding
- H339 (= H346) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N348) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D373) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
73% identity, 97% coverage: 14:452/452 of query aligns to 3:442/442 of 1ec8A
- active site: K201 (= K212), K203 (= K214), D231 (= D242), N233 (= N244), E256 (= E267), N285 (= N296), M286 (= M297), D309 (= D320), H335 (= H346), N337 (= N348), I361 (= I372)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N34), H28 (= H39), T99 (= T110), Y146 (= Y157), K203 (= K214), D231 (= D242), N233 (= N244), N285 (= N296), H335 (= H346), S336 (= S347), N337 (= N348), H364 (= H375), R418 (= R428)
- binding magnesium ion: D231 (= D242), E256 (= E267), N285 (= N296)
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
73% identity, 97% coverage: 14:452/452 of query aligns to 5:444/444 of 1ecqA
- active site: K203 (= K212), K205 (= K214), D233 (= D242), N235 (= N244), E258 (= E267), N287 (= N296), M288 (= M297), D311 (= D320), H337 (= H346), N339 (= N348), I363 (= I372)
- binding 4-deoxyglucarate: N25 (= N34), H30 (= H39), T101 (= T110), Y148 (= Y157), F150 (= F159), K205 (= K214), D233 (= D242), N235 (= N244), N287 (= N296), H337 (= H346), S338 (= S347), N339 (= N348), H366 (= H375), R420 (= R428)
- binding magnesium ion: D233 (= D242), E258 (= E267), N287 (= N296)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
73% identity, 97% coverage: 14:452/452 of query aligns to 5:444/444 of 1ec9D
- active site: K203 (= K212), K205 (= K214), D233 (= D242), N235 (= N244), E258 (= E267), N287 (= N296), M288 (= M297), D311 (= D320), H337 (= H346), N339 (= N348), I363 (= I372)
- binding magnesium ion: D233 (= D242), E258 (= E267), N287 (= N296)
- binding xylarohydroxamate: H30 (= H39), T101 (= T110), Y148 (= Y157), F150 (= F159), K205 (= K214), D233 (= D242), N235 (= N244), N287 (= N296), H337 (= H346), S338 (= S347), N339 (= N348), H366 (= H375), R420 (= R428)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
73% identity, 97% coverage: 14:452/452 of query aligns to 4:443/443 of 1jctA
- active site: K202 (= K212), K204 (= K214), D232 (= D242), N234 (= N244), E257 (= E267), N286 (= N296), M287 (= M297), D310 (= D320), H336 (= H346), L338 (≠ N348), I362 (= I372)
- binding d-glucarate: N24 (= N34), H29 (= H39), T100 (= T110), Y147 (= Y157), F149 (= F159), K204 (= K214), D232 (= D242), N286 (= N296), S337 (= S347), R419 (= R428)
- binding magnesium ion: D232 (= D242), E257 (= E267), N286 (= N296)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
68% identity, 97% coverage: 14:450/452 of query aligns to 2:424/425 of 3nxlC
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
66% identity, 97% coverage: 14:450/452 of query aligns to 2:428/428 of 3p0wB
- active site: K189 (= K212), K191 (= K214), D219 (= D242), N221 (= N244), E244 (= E267), N273 (= N296), D297 (= D320), H323 (= H346), N325 (= N348)
- binding d-glucarate: H27 (= H39), Y134 (= Y157), K191 (= K214), D219 (= D242), N221 (= N244), N273 (= N296), H323 (= H346), N325 (= N348), H352 (= H375), R406 (= R428)
- binding magnesium ion: D219 (= D242), E244 (= E267), N273 (= N296)
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
58% identity, 97% coverage: 13:451/452 of query aligns to 1:440/441 of 3nfuA
- active site: K201 (= K212), K203 (= K214), D231 (= D242), N233 (= N244), E256 (= E267), N285 (= N296), D309 (= D320), H335 (= H346), N337 (= N348)
- binding magnesium ion: D231 (= D242), N233 (= N244), E256 (= E267), D257 (= D268), N285 (= N296)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
58% identity, 97% coverage: 14:452/452 of query aligns to 3:430/432 of 3n6hB
- active site: K189 (= K212), K191 (= K214), D219 (= D242), N221 (= N244), E244 (= E267), N273 (= N296), D297 (= D320), H323 (= H346), N325 (= N348)
- binding magnesium ion: D219 (= D242), E244 (= E267), N273 (= N296)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
58% identity, 97% coverage: 14:452/452 of query aligns to 2:426/426 of 3pfrA
- active site: K185 (= K212), K187 (= K214), D215 (= D242), N217 (= N244), E240 (= E267), N269 (= N296), D293 (= D320), H319 (= H346), N321 (= N348)
- binding d-glucarate: N22 (= N34), H27 (= H39), Y130 (= Y157), F132 (= F159), K187 (= K214), D215 (= D242), N217 (= N244), N269 (= N296), H319 (= H346), S320 (= S347), N321 (= N348), H348 (= H375)
- binding magnesium ion: D215 (= D242), E240 (= E267), N269 (= N296)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
36% identity, 97% coverage: 10:448/452 of query aligns to 6:425/427 of 3va8A
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
36% identity, 94% coverage: 16:442/452 of query aligns to 3:414/420 of 3vc6A
- active site: D52 (≠ G65), H55 (≠ I68), Y146 (= Y157), K188 (= K212), K190 (= K214), D218 (= D242), N220 (= N244), E243 (= E267), N266 (= N296), M267 (= M297), D290 (= D320), H317 (= H346), S318 (= S347), N319 (= N348), H321 (= H350), C343 (≠ I372), D344 (= D373)
- binding magnesium ion: D218 (= D242), E243 (= E267), N266 (= N296)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
36% identity, 94% coverage: 17:441/452 of query aligns to 6:420/427 of 4it1D
- active site: S51 (≠ V62), D54 (≠ G65), A98 (≠ L108), Y150 (= Y157), K194 (= K212), K196 (= K214), D224 (= D242), N226 (= N244), Y247 (= Y265), E249 (= E267), T271 (= T295), N272 (= N296), M273 (= M297), D296 (= D320), H323 (= H346), S324 (= S347), N325 (= N348), C349 (≠ I372), D350 (= D373)
- binding magnesium ion: D224 (= D242), E249 (= E267), N272 (= N296)
4h1zB Crystal structure of putative isomerase from sinorhizobium meliloti, open loop conformation (target efi-502104)
27% identity, 83% coverage: 41:415/452 of query aligns to 46:384/388 of 4h1zB
- active site: G70 (= G64), V72 (≠ E66), Y113 (≠ F111), I157 (= I161), F180 (= F208), S182 (≠ D210), K184 (= K212), A186 (≠ K214), D214 (= D242), H216 (≠ N244), E240 (= E267), G265 (≠ A299), E266 (≠ T300), Q287 (≠ D320), P288 (= P321), E289 (≠ H322), H315 (= H350), A316 (≠ F351), T317 (≠ D352), E341 (vs. gap)
- binding magnesium ion: D214 (= D242), E240 (= E267), E266 (≠ T300)
3i6eA Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
24% identity, 75% coverage: 76:413/452 of query aligns to 59:349/356 of 3i6eA
- active site: S124 (≠ Y157), K149 (≠ R197), K151 (≠ Q200), D179 (= D242), Y180 (≠ P243), N181 (= N244), Q182 (≠ G245), E205 (= E267), D230 (≠ N296), E231 (≠ M297), S232 (≠ V298), K254 (≠ P317), Y279 (≠ H346), G281 (≠ N348), D282 (≠ N349), M283 (≠ H350), C307 (≠ I372), E308 (≠ D373), F309 (≠ T374)
- binding magnesium ion: D179 (= D242), E205 (= E267), D230 (≠ N296)
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
26% identity, 76% coverage: 75:418/452 of query aligns to 58:355/363 of 2og9A
- active site: T132 (= T167), K160 (= K212), K162 (= K214), D191 (= D242), N193 (= N244), E217 (= E267), G242 (≠ N296), E243 (≠ M297), M264 (≠ L318), D266 (= D320), H293 (= H346), F294 (≠ I353), A295 (≠ S354), E313 (≠ I372)
- binding calcium ion: A232 (≠ M282), F235 (= F285)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
25% identity, 72% coverage: 95:418/452 of query aligns to 90:366/373 of 3cb3A
- active site: T143 (= T167), K171 (= K212), K173 (= K214), D202 (= D242), N204 (= N244), E228 (= E267), G253 (≠ N296), E254 (≠ M297), M275 (≠ L318), D277 (= D320), H304 (= H346), F305 (≠ I353), A306 (≠ S354), E324 (≠ I372)
- binding l-glucaric acid: K171 (= K212), K173 (= K214), D202 (= D242), E254 (≠ M297), H304 (= H346)
- binding magnesium ion: D202 (= D242), E228 (= E267), A243 (≠ M282), F246 (= F285), E254 (≠ M297)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
25% identity, 82% coverage: 44:413/452 of query aligns to 18:345/351 of 5olcC
- active site: K148 (= K212), K150 (= K214), D178 (= D242), N180 (= N244), E204 (= E267), G229 (≠ N296), E230 (≠ A299), D253 (≠ H322), H280 (vs. gap), E304 (≠ A371), E309 (≠ H375)
- binding magnesium ion: D178 (= D242), E204 (= E267), E230 (≠ A299)
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
27% identity, 84% coverage: 47:425/452 of query aligns to 25:384/397 of 3rcyF
- active site: K165 (≠ G207), D167 (≠ N209), R175 (≠ K214), G208 (≠ D242), H210 (≠ N244), E234 (≠ A266), G259 (≠ N296), E260 (≠ M297), Q281 (≠ D320), A283 (≠ H322), H310 (= H346), A313 (≠ N349), L332 (≠ V369), E335 (≠ I372)
- binding magnesium ion: E234 (≠ A266), E260 (≠ M297)
- binding alpha-D-ribofuranose: R85 (= R101), P86 (≠ D102), P239 (vs. gap), A266 (≠ R303), E267 (≠ Q304)
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
25% identity, 75% coverage: 76:414/452 of query aligns to 71:360/364 of 3i6tB
- active site: S136 (≠ Y157), K161 (≠ R197), K163 (≠ Q200), D191 (= D242), N193 (= N244), E217 (= E267), D242 (≠ N296), E243 (≠ M297), S262 (≠ D315), K264 (≠ P317), G291 (≠ N348), D292 (≠ N349), M293 (≠ H350), C317 (≠ I372), E318 (≠ D373), F319 (vs. gap)
- binding magnesium ion: D191 (= D242), E217 (= E267), D242 (≠ N296)
Sites not aligning to the query:
Query Sequence
>RR42_RS10625 FitnessBrowser__Cup4G11:RR42_RS10625
MNPTQTHSASIGLTPVVTELTVVPVAGHDSMLMNLSGAHGPFFTRNIVILKDSAGNTGVG
EVPGGEAIRQTLEDARELLAGQSIGNHQALLNRVRTAFASRDAGGRGLQTFDLRIAIHAV
TALEAALLDLLGKHLGVPVAALLGEGQQRDAVEMLGYLFYIGDRNRTTLGYRSEPEADND
WFRLRNEAAMNAEGVVRLAQAAYERYGFNDFKLKGGVLRGDEEMEAILALAERFPKARIT
LDPNGAWSLAEAVRLCRDKHGVLAYAEDPCGAQEGYSGREIMAEFRTATGLPTATNMVAT
DWRQMGHAVRLQSVDIPLADPHFWTMQGSVRVAQMCAEWGLTWGSHSNNHFDISLAMFTH
VAAAAPGRVTAIDTHWIWQDGERLTKAPLKIENGKVAVPTAPGLGVELDMEQLALAHERY
KNMGLGARDDAVAMQFLIPGWTFDNKAPCMVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory