Comparing RR42_RS10690 FitnessBrowser__Cup4G11:RR42_RS10690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
51% identity, 99% coverage: 1:257/259 of query aligns to 1:259/261 of 2xuaH
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
30% identity, 92% coverage: 21:259/259 of query aligns to 26:269/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
30% identity, 92% coverage: 21:259/259 of query aligns to 26:269/278 of 4uhfA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
30% identity, 92% coverage: 21:259/259 of query aligns to 26:269/274 of 4uhdA
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:257/259 of query aligns to 1:260/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:257/259 of query aligns to 1:263/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 99% coverage: 1:257/259 of query aligns to 1:257/262 of 6eb3C
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
28% identity, 98% coverage: 3:257/259 of query aligns to 9:273/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
28% identity, 98% coverage: 3:257/259 of query aligns to 9:273/276 of 4lxiA
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
28% identity, 98% coverage: 3:257/259 of query aligns to 9:273/276 of 4lxhA
A0A109QYD3 Strigolactone esterase RMS3; Protein DWARF 14 homolog; PsD14; Protein RAMOSUS 3; EC 3.1.-.- from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
24% identity, 80% coverage: 24:229/259 of query aligns to 21:235/267 of A0A109QYD3
Sites not aligning to the query:
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
22% identity, 88% coverage: 10:237/259 of query aligns to 8:244/269 of O07015
Sites not aligning to the query:
6o5jA Crystal structure of dad2 bound to quinazolinone derivative (see paper)
25% identity, 86% coverage: 23:244/259 of query aligns to 18:242/264 of 6o5jA
Sites not aligning to the query:
6ap7A Crystal structure of dad2 in complex with 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
25% identity, 86% coverage: 23:244/259 of query aligns to 18:242/264 of 6ap7A
Sites not aligning to the query:
6ap6A Crystal structure of dad2 in complex with tolfenamic acid (see paper)
25% identity, 86% coverage: 23:244/259 of query aligns to 18:242/264 of 6ap6A
Sites not aligning to the query:
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
26% identity, 86% coverage: 23:244/259 of query aligns to 18:249/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
26% identity, 86% coverage: 23:244/259 of query aligns to 18:249/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
26% identity, 86% coverage: 23:244/259 of query aligns to 18:249/265 of 5yz7A
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
26% identity, 86% coverage: 23:244/259 of query aligns to 17:248/264 of 5zhsA
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
26% identity, 86% coverage: 23:244/259 of query aligns to 21:252/268 of 4ihaA
>RR42_RS10690 FitnessBrowser__Cup4G11:RR42_RS10690
MPFAEFPGVRLHYRLDGDDTLPVLVLANSLGTNLDMWNPQIEAFAKHFRVLRYDTRGHGQ
SSVTPGPYTIPQLGEDVIALLDALKIDRAHFCGLSMGGITGMWLALNHAGRFDKVVLCNT
AAYIGPAENWTNRAAAVERDGVGSIANAVVDKWLTPGYAAGQPALVQLLQAMLSATDAAG
YAANCRAVRDSDLRDAVAGITRPTLVIAGSGDIPTPPHDGQYLAQKIPGARYAELDAAHL
SNLEQVEGFTDAVLEFLQN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory