SitesBLAST
Comparing RR42_RS10775 FitnessBrowser__Cup4G11:RR42_RS10775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
43% identity, 92% coverage: 12:409/434 of query aligns to 20:421/478 of Q47945
- Q37 (≠ D28) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
43% identity, 87% coverage: 33:409/434 of query aligns to 4:383/433 of 8gy2B
- binding heme c: C18 (= C47), C21 (= C50), H22 (= H51), T46 (= T75), I48 (= I77), Y59 (= Y88), L68 (= L97), R73 (≠ A102), V79 (≠ L108), Y80 (= Y109), M83 (= M112), F88 (≠ Y117), R126 (= R155), H165 (= H193), C166 (= C194), C169 (= C197), H170 (= H198), I201 (≠ A227), A202 (≠ S228), P203 (≠ T229), L205 (= L231), W216 (= W242), F224 (≠ Y250), A234 (≠ T260), V235 (≠ S261), F236 (= F262), F236 (= F262), M239 (= M265), N301 (≠ F327), C302 (= C328), C305 (= C331), H306 (= H332), M316 (≠ V342), F317 (= F343), P318 (= P344), L320 (= L346), P324 (= P350), G342 (≠ A368), S352 (≠ T378), V354 (≠ Y380), M356 (= M382), F359 (≠ Y385), M375 (≠ I401)
- binding ubiquinone-10: C21 (= C50), L34 (= L63), P39 (≠ G68), P81 (= P110), L129 (= L158), W132 (= W161), E168 (≠ A196), R173 (= R201), I197 (≠ V223), D241 (≠ E267)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
37% identity, 91% coverage: 35:427/434 of query aligns to 1:391/418 of 7w2jC
- binding heme c: C13 (= C47), C16 (= C50), H17 (= H51), T42 (= T75), I44 (= I77), Y55 (= Y88), L75 (= L108), Y76 (= Y109), A78 (= A111), M79 (= M112), R122 (= R155), H161 (= H193), C162 (= C194), C165 (= C197), H166 (= H198), A191 (≠ S228), P192 (≠ T229), R223 (≠ T260), P227 (= P264), M228 (= M265), V289 (≠ F327), C290 (= C328), C293 (= C331), H294 (= H332), Y305 (≠ V342), Y306 (≠ F343), P307 (= P344), L309 (= L346), N312 (= N349), T313 (≠ P350), T314 (= T351), D322 (≠ S359), I327 (≠ L364), V331 (≠ A368), R333 (≠ A376), I340 (vs. gap), M342 (= M382), P343 (= P383), F345 (≠ Y385)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
37% identity, 91% coverage: 35:427/434 of query aligns to 1:405/413 of 8jejC
- binding heme c: C13 (= C47), C16 (= C50), H17 (= H51), T42 (= T75), I44 (= I77), F60 (= F93), L64 (= L97), L75 (= L108), Y76 (= Y109), M79 (= M112), P80 (= P113), Y84 (= Y117), R122 (= R155), C162 (= C194), C165 (= C197), H166 (= H198), I186 (≠ V223), W189 (= W226), A191 (≠ S228), P192 (≠ T229), I194 (≠ L231), W205 (= W242), Y213 (= Y250), R223 (≠ T260), M228 (= M265), V303 (≠ F327), C304 (= C328), C307 (= C331), H308 (= H332), Y320 (≠ F343), P321 (= P344), L323 (= L346), T327 (≠ P350), T328 (= T351), D336 (≠ S359), I341 (≠ L364), V345 (≠ A368), R347 (≠ A376), I354 (vs. gap), M356 (= M382), F359 (≠ Y385), I376 (≠ V397)
- binding ubiquinone-10: M36 (≠ V69), P77 (= P110), S124 (≠ L157), W128 (= W161), C165 (= C197), L173 (≠ M205)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 88% coverage: 19:402/434 of query aligns to 25:408/440 of 8gy3A
- binding heme c: Y52 (≠ N46), C53 (= C47), C56 (= C50), H57 (= H51), S84 (≠ T75), I86 (= I77), W97 (≠ Y88), F102 (= F93), L117 (= L108), F121 (≠ M112), F126 (≠ Y117), R163 (= R155), C203 (= C194), C206 (= C197), H207 (= H198), A232 (≠ S228), P233 (≠ T229), L235 (= L231), W245 (= W242), Y253 (= Y250), L254 (= L251), G263 (≠ A259), S264 (≠ T260), M269 (= M265), Y292 (≠ L288), C337 (= C328), C340 (= C331), H341 (= H332), P353 (= P344), L355 (= L346), N358 (= N349), N359 (≠ P350), V372 (≠ L363), I377 (≠ V369), G382 (= G374), Q383 (≠ T375), I386 (≠ T378), M388 (= M382), F391 (≠ Y385)
- binding ubiquinone-10: E55 (≠ A49), T76 (= T67), F78 (≠ V69), Y118 (= Y109), P119 (= P110), I160 (≠ F152), G166 (≠ L158), Q167 (≠ R159), F169 (≠ V160), W170 (= W161), H202 (= H193), R210 (= R201), L213 (= L204)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
31% identity, 31% coverage: 286:421/434 of query aligns to 309:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C328), C350 (= C331), H351 (= H332), F362 (= F343), P363 (= P344), P364 (= P345), L365 (= L346), S368 (≠ N349), Y370 (≠ V352), I382 (≠ L364), L386 (≠ V369), S387 (≠ T370), G388 (≠ A371), I390 (≠ V373), V392 (≠ T375), Y397 (= Y380), N398 (≠ H381), G399 (≠ M382), V400 (≠ P383), M401 (≠ G384)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
34% identity, 26% coverage: 310:421/434 of query aligns to 14:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C328), C33 (= C331), H34 (= H332), Y46 (≠ F343), P47 (= P344), T54 (= T351), V66 (≠ L363), I67 (≠ L364), R73 (≠ A371), I80 (≠ Y380), M82 (= M382), P83 (= P383)
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
33% identity, 23% coverage: 324:422/434 of query aligns to 359:456/457 of 4ax3D
- binding heme c: C363 (= C328), C366 (= C331), H367 (= H332), P379 (= P344), P380 (= P345), L381 (= L346), S384 (≠ N349), F386 (≠ V352), N403 (≠ T370), G404 (≠ A371), S415 (vs. gap), M417 (= M382), M420 (≠ Y385)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
33% identity, 23% coverage: 324:422/434 of query aligns to 356:453/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ F327), C360 (= C328), C363 (= C331), H364 (= H332), P376 (= P344), P377 (= P345), L378 (= L346), F383 (≠ V352), N400 (≠ T370), G401 (≠ A371), Y410 (= Y380), S412 (vs. gap), M414 (= M382), M417 (≠ Y385)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
33% identity, 23% coverage: 324:422/434 of query aligns to 357:454/456 of 5oboA
- binding heme c: T360 (≠ F327), C361 (= C328), C364 (= C331), H365 (= H332), P377 (= P344), P378 (= P345), L379 (= L346), S382 (≠ N349), F384 (≠ V352), I395 (≠ L363), N401 (≠ T370), G402 (≠ A371), S413 (vs. gap), M415 (= M382), M418 (≠ Y385)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
35% identity, 22% coverage: 318:413/434 of query aligns to 2:98/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C328), C14 (= C331), H15 (= H332), F26 (= F343), P27 (= P344), L29 (= L346), H32 (≠ N349), Y45 (≠ S359), L54 (≠ V369), Q55 (≠ T370), G56 (≠ A371), G67 (vs. gap), M69 (= M382), F72 (≠ Y385)
Sites not aligning to the query:
5djqC The structure of cbb3 cytochrome oxidase. (see paper)
31% identity, 19% coverage: 320:402/434 of query aligns to 135:206/303 of 5djqC
- binding heme c: Y142 (≠ F327), C143 (= C328), C146 (= C331), H147 (= H332), F157 (= F343), P158 (= P344), W165 (≠ T351), R166 (≠ V352), R166 (≠ V352), W167 (≠ V353), S177 (≠ L363), I178 (≠ L364), A184 (≠ T370), A184 (≠ T370), M186 (= M382), P187 (= P383), W189 (≠ Y385)
Sites not aligning to the query:
- binding hexacyanoferrate(3-): 215, 264, 266, 269
- binding heme c: 232, 233, 236, 237, 247, 248, 250, 258, 259, 260, 270, 271, 277, 277, 278, 279, 280, 282
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
35% identity, 22% coverage: 318:413/434 of query aligns to 1:97/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C331), H14 (= H332), P26 (= P344), L28 (= L346), H31 (≠ N349), Y44 (≠ S359), V48 (≠ L363), Q54 (≠ T370), G55 (≠ A371), G66 (vs. gap), M68 (= M382)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
35% identity, 22% coverage: 318:413/434 of query aligns to 1:97/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y324), C10 (= C328), C13 (= C331), H14 (= H332), P26 (= P344), H31 (≠ N349), Y44 (≠ S359), Q54 (≠ T370), G55 (≠ A371), G66 (vs. gap), M68 (= M382), F71 (≠ Y385)
Sites not aligning to the query:
Query Sequence
>RR42_RS10775 FitnessBrowser__Cup4G11:RR42_RS10775
MSLATRRFSATVAFAVLLLAPCFAAAADAPGAAQVERGRYLAKVANCAACHTSVGGAPFA
GGLPLKTGVGTVYSTNITPDVDSGIGAYSFEEFDRALREGVARHGKRLYPAMPYPSYARL
AEPDVQALYAYLRTEVKAVRQATAEPEMRWPFGMRWLLRVWNWLFLESGPVPANAGQSVE
WNRGAYLVQAVAHCGACHTPRGMLMAEKGLDERSRHFLAGASVEGWASTNLRGDPRTGLG
TWSREDIAEYLHTGRNAHATSFGPMSEVIASSTQFMTRPDLDAVAVYLKSVPGARSDETP
YAYDAHTADALAQGRFDATGARQYAEFCMPCHGANGKGFARVFPPLAGNPTVVDPDPSSL
ANLLLDGAVTAHVGTAATDYHMPGYGWTLDNQELANVLTFIRTGWGNQASQVKEATVAAR
RAALGRQRDAAESR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory