Comparing RR42_RS10790 FitnessBrowser__Cup4G11:RR42_RS10790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
35% identity, 46% coverage: 48:275/501 of query aligns to 265:500/506 of A0A0H2ZQB9
Sites not aligning to the query:
7txlA Crystal structure of egtu solute binding domain from streptococcus pneumoniae d39 in complex with l-ergothioneine (see paper)
35% identity, 45% coverage: 53:275/501 of query aligns to 39:269/275 of 7txlA
Sites not aligning to the query:
6v1rA Crystal structure of iachsnfr fluorescent acetylcholine sensor precursor binding protein
32% identity, 51% coverage: 20:275/501 of query aligns to 3:271/278 of 6v1rA
7s7xA Crystal structure of icytsnfr cytisine sensor precursor binding protein with varenicline bound
32% identity, 51% coverage: 20:275/501 of query aligns to 3:271/278 of 7s7xA
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
32% identity, 50% coverage: 22:273/501 of query aligns to 290:548/553 of B5Z7I3
8dp7A Structure of helicobacter pylori egtu bound to egt (see paper)
32% identity, 50% coverage: 22:274/501 of query aligns to 2:261/265 of 8dp7A
1sw1A Crystal structure of prox from archeoglobus fulgidus in complex with proline betaine (see paper)
32% identity, 50% coverage: 24:275/501 of query aligns to 5:265/270 of 1sw1A
7s7tA Inicsnfr3a nicotine sensor comprising periplasmic binding sequence plus fluorescent sequence with varenicline bound (see paper)
35% identity, 33% coverage: 110:275/501 of query aligns to 337:504/509 of 7s7tA
Sites not aligning to the query:
6eylA Crystal structure of opubc in complex with carnitine
28% identity, 52% coverage: 16:274/501 of query aligns to 3:273/280 of 6eylA
6eyhA Structure of a opubc mutant with bound glycine betaine
28% identity, 52% coverage: 16:274/501 of query aligns to 3:273/280 of 6eyhA
3ppoA Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc (see paper)
28% identity, 51% coverage: 20:274/501 of query aligns to 1:266/272 of 3ppoA
3pprA Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc (see paper)
28% identity, 51% coverage: 21:274/501 of query aligns to 1:265/271 of 3pprA
3ppqA Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc (see paper)
28% identity, 51% coverage: 21:274/501 of query aligns to 1:265/271 of 3ppqA
3r6uA Crystal structure of choline binding protein opubc from bacillus subtilis (see paper)
27% identity, 51% coverage: 21:274/501 of query aligns to 2:266/272 of 3r6uA
5nxyA Crystal structure of opuac from b. Subtilis in complex with arsenobetaine (see paper)
27% identity, 51% coverage: 21:274/501 of query aligns to 2:266/272 of 5nxyA
>RR42_RS10790 FitnessBrowser__Cup4G11:RR42_RS10790
MCWAVACLSLLATAGTARADTLRVGSKRFTESYILGEVLTQTAAAQASAQHTPGLGNTAI
VFEALKAGSIDLYPDYTGTVSSEILKLPPGASLAQINQALAPLGLAAGIPLGFENTYALA
MEEHKARQLGLAALGDLAAQPQLRLGLSHEFLGRADGWPGLARRYGLPQRPLGLDHGVAY
EALANGQVDAIDIYSTDAKIRKYGLRVLTDDRHYFPRYDAVVLYRLDLPQRFPAAWQALT
GLAGKVSAADMIAMNAAAELDGQSFAAVARAFLAHGNASVADATASARAGLAGTLFGRDT
LRLTCRHLALVLGAVGAASLLGVPLGIVAARRRRLGQVLMATVSVLQTVPSLALLAMLIP
LLGRIGVWPAMVALFLYALLPIVRNTLTGLQQVPAGMREAARALGFTPGQVLRYVELPLS
MPVLLAGIKTAAIISVGTATIAAFVGAGGYGERIATGLALNDHVLLMAGAIPAAVLALLV
QAGFGLGEWYLGRHARSGTVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory