Comparing RR42_RS10815 FitnessBrowser__Cup4G11:RR42_RS10815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
40% identity, 88% coverage: 13:306/336 of query aligns to 5:298/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
40% identity, 88% coverage: 13:306/336 of query aligns to 4:287/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 90% coverage: 10:313/336 of query aligns to 1:312/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 69% coverage: 34:266/336 of query aligns to 21:247/250 of 7z18I
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 69% coverage: 34:266/336 of query aligns to 21:247/253 of 7z15I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 69% coverage: 34:266/336 of query aligns to 21:247/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 74% coverage: 22:270/336 of query aligns to 11:248/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 74% coverage: 22:270/336 of query aligns to 12:249/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 74% coverage: 22:270/336 of query aligns to 12:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 74% coverage: 22:270/336 of query aligns to 12:249/344 of 3tuiC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 72% coverage: 25:267/336 of query aligns to 15:247/375 of 2d62A
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 83% coverage: 31:310/336 of query aligns to 19:273/393 of P9WQI3
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 77% coverage: 11:270/336 of query aligns to 16:255/378 of P69874
Sites not aligning to the query:
1g291 Malk (see paper)
33% identity, 72% coverage: 27:267/336 of query aligns to 14:244/372 of 1g291
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 74% coverage: 21:270/336 of query aligns to 11:235/353 of 1vciA
8hplC Lpqy-sugabc in state 1 (see paper)
32% identity, 71% coverage: 31:270/336 of query aligns to 16:238/384 of 8hplC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
25% identity, 98% coverage: 6:333/336 of query aligns to 16:320/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
25% identity, 98% coverage: 6:333/336 of query aligns to 16:320/382 of 7aheC
7mdyC Lolcde nucleotide-bound
33% identity, 63% coverage: 34:244/336 of query aligns to 24:223/226 of 7mdyC
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 62% coverage: 34:242/336 of query aligns to 24:221/222 of 7arlD
>RR42_RS10815 FitnessBrowser__Cup4G11:RR42_RS10815
MTAPDIDNAVPTLEVRHLRTHFETRAGVLPAVDDVSFTVPRGRILGLVGESGSGKSVTGF
SIMGLVDPPGRIAGGEILFQGRELTRMRPAELRQLQGNRIAMIFQDPMMTLNPVMRVDAQ
MIEAVRAHSPASHKQARELARDTLGMMGIPSPEERLRAYPHQLSGGMRQRVAIAIAMLHR
PDLIIADEPTTALDVTIQAQILSEVQKLARLHGTALIWITHDLSVVAGLADEVAVMYAGR
IVEQGPVDAVLDHPLHPYTAGLIGSLPSLNQRGQRLRQIPGMTPNLLTMPPGCAFAARCP
RVSGACVQAPAITSPQALRQVRCFHPGQPAIAAEFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory