SitesBLAST
Comparing RR42_RS11110 FitnessBrowser__Cup4G11:RR42_RS11110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
71% identity, 100% coverage: 2:320/320 of query aligns to 1:319/319 of A4F2N8
- K53 (= K54) mutation to A: Loss of enzymatic activity.
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
69% identity, 99% coverage: 2:319/320 of query aligns to 5:322/323 of O59791
- S82 (= S79) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
69% identity, 99% coverage: 2:319/320 of query aligns to 1:318/319 of 2zr8A
- active site: K53 (= K54), S78 (= S79), E204 (= E205), G208 (= G209), D210 (= D211), G232 (= G233), I303 (= I304), S304 (= S305)
- binding magnesium ion: E204 (= E205), G208 (= G209), D210 (= D211)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F53), K53 (= K54), S77 (= S78), S78 (= S79), N80 (= N81), H81 (= H82), P147 (= P148), G179 (= G180), G180 (= G181), G181 (= G182), G182 (= G183), G232 (= G233), E277 (= E278), T279 (= T280), S304 (= S305)
- binding serine: S78 (= S79), R129 (= R130), D231 (= D232), G232 (= G233), A233 (= A234), Q234 (= Q235), T235 (= T236)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
69% identity, 99% coverage: 2:319/320 of query aligns to 1:318/319 of 2zpuA
- active site: K53 (= K54), S78 (= S79), E204 (= E205), G208 (= G209), D210 (= D211), G232 (= G233), I303 (= I304), S304 (= S305)
- binding magnesium ion: E204 (= E205), G208 (= G209), D210 (= D211)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F53), K53 (= K54), S77 (= S78), S78 (= S79), N80 (= N81), H81 (= H82), P147 (= P148), G179 (= G180), G180 (= G181), G181 (= G182), G182 (= G183), G232 (= G233), E277 (= E278), T279 (= T280), S304 (= S305)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
69% identity, 99% coverage: 4:319/320 of query aligns to 2:317/318 of 1wtcA
- active site: K52 (= K54), S77 (= S79), E203 (= E205), G207 (= G209), D209 (= D211), G231 (= G233), I302 (= I304), S303 (= S305)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ H22), K47 (≠ R49), M48 (= M50), A109 (= A111), A110 (= A112), Y114 (= Y116)
- binding magnesium ion: E203 (= E205), G207 (= G209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (= G233), E276 (= E278), T278 (= T280), S303 (= S305)
1v71A Crystal structure of s.Pombe serine racemase
69% identity, 99% coverage: 4:319/320 of query aligns to 2:317/318 of 1v71A
- active site: K52 (= K54), S77 (= S79), E203 (= E205), G207 (= G209), D209 (= D211), G231 (= G233), I302 (= I304), S303 (= S305)
- binding magnesium ion: E203 (= E205), G207 (= G209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (= G233), E276 (= E278), T278 (= T280), S303 (= S305), G304 (= G306)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
42% identity, 93% coverage: 13:311/320 of query aligns to 27:329/339 of Q7XSN8
- E219 (= E205) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D211) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
5cvcA Structure of maize serine racemase (see paper)
42% identity, 95% coverage: 7:311/320 of query aligns to 5:313/329 of 5cvcA
- active site: K52 (= K54), S77 (= S79), E203 (= E205), A207 (≠ G209), D209 (= D211), G231 (= G233), V306 (≠ I304), S307 (= S305)
- binding magnesium ion: E203 (= E205), A207 (≠ G209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), S178 (≠ G180), G179 (= G181), G180 (= G182), G181 (= G183), L232 (≠ A234), E275 (= E278), S307 (= S305), G308 (= G306)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:316/322 of 7nbgAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ G209), D213 (= D211), G236 (= G233), L309 (≠ I304), S310 (= S305)
- binding calcium ion: E207 (= E205), A211 (≠ G209), D213 (= D211)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ A234), T282 (= T280), S310 (= S305), G311 (= G306)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S79), G85 (≠ A83), Q86 (= Q84), I101 (= I99), K111 (= K109), I115 (≠ T113), Y118 (= Y116)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:316/323 of 7nbfAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ G209), D213 (= D211), G236 (= G233), L309 (≠ I304), S310 (= S305)
- binding calcium ion: E207 (= E205), A211 (≠ G209), D213 (= D211)
- binding magnesium ion: N244 (≠ Y242)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ A234), T282 (= T280), S310 (= S305), G311 (= G306)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (= H22), L22 (≠ R23), T23 (= T24), P24 (= P25), L26 (≠ M27), T27 (≠ R28), F46 (≠ L47)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:316/323 of 7nbdAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ G209), D213 (= D211), G236 (= G233), L309 (≠ I304), S310 (= S305)
- binding calcium ion: E207 (= E205), A211 (≠ G209), D213 (= D211)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ A270), L278 (≠ V276), V314 (≠ I309), L316 (≠ I311)
- binding magnesium ion: N244 (≠ Y242)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ A234), E280 (= E278), T282 (= T280), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:316/323 of 7nbcCCC
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ G209), D213 (= D211), G236 (= G233), L309 (≠ I304), S310 (= S305)
- binding biphenyl-4-ylacetic acid: T78 (≠ A76), H79 (≠ Y77), H84 (= H82), V148 (≠ I146), H149 (≠ P147), P150 (= P148)
- binding calcium ion: E207 (= E205), A211 (≠ G209), D213 (= D211)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ A234), T282 (= T280), S310 (= S305), G311 (= G306)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:316/323 of 7nbcAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ G209), D213 (= D211), G236 (= G233), L309 (≠ I304), S310 (= S305)
- binding calcium ion: E207 (= E205), A211 (≠ G209), D213 (= D211)
- binding magnesium ion: N244 (≠ Y242)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ A234), T282 (= T280), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 6:312/322 of 3l6bA
- active site: K54 (= K54), S77 (= S79), E203 (= E205), A207 (≠ G209), D209 (= D211), G232 (= G233), T278 (= T280), L305 (≠ I304), S306 (= S305)
- binding malonate ion: K54 (= K54), S76 (= S78), S77 (= S79), N79 (= N81), H80 (= H82), R128 (= R130), G232 (= G233)
- binding manganese (ii) ion: E203 (= E205), A207 (≠ G209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F53 (= F53), K54 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), M182 (≠ L184), V233 (≠ A234), E276 (= E278), T278 (= T280), S306 (= S305), G307 (= G306)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:316/320 of 7nbhAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (≠ G209), D213 (= D211), G236 (= G233), L309 (≠ I304), S310 (= S305)
- binding calcium ion: E207 (= E205), A211 (≠ G209), D213 (= D211)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S79), G85 (≠ A83), Q86 (= Q84), K111 (= K109), I115 (≠ T113), Y118 (= Y116), D235 (= D232), P281 (= P279), N313 (= N308), V314 (≠ I309), D315 (= D310)
6zspAAA serine racemase bound to atp and malonate. (see paper)
41% identity, 96% coverage: 6:311/320 of query aligns to 5:309/320 of 6zspAAA
- active site: K53 (= K54), S74 (= S79), E200 (= E205), A204 (≠ G209), D206 (= D211), G229 (= G233), L302 (≠ I304), S303 (= S305)
- binding adenosine-5'-triphosphate: S28 (= S29), S29 (≠ R30), I30 (≠ T31), K48 (≠ R49), T49 (≠ M50), Q79 (= Q84), Y111 (= Y116), E266 (≠ S271), R267 (= R272), K269 (= K274), N306 (= N308)
- binding magnesium ion: E200 (= E205), A204 (≠ G209), D206 (= D211)
- binding malonate ion: K53 (= K54), S73 (= S78), S74 (= S79), N76 (= N81), H77 (= H82), R125 (= R130), G229 (= G233), S232 (≠ T236)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
41% identity, 95% coverage: 6:310/320 of query aligns to 5:310/310 of 7nbgDDD
- active site: K53 (= K54), S76 (= S79), E202 (= E205), A206 (≠ G209), D208 (= D211), G231 (= G233), L304 (≠ I304), S305 (= S305)
- binding calcium ion: E202 (= E205), A206 (≠ G209), D208 (= D211)
- binding magnesium ion: N239 (≠ Y242)
- binding ortho-xylene: S76 (= S79), Q81 (= Q84), I96 (= I99), Y113 (= Y116)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N78 (= N81), G177 (= G180), G178 (= G181), G179 (= G182), G180 (= G183), M181 (≠ L184), G231 (= G233), V232 (≠ A234), E275 (= E278), T277 (= T280), S305 (= S305), G306 (= G306)
Sites not aligning to the query:
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
44% identity, 96% coverage: 5:312/320 of query aligns to 1:307/308 of 1ve5A
- active site: K50 (= K54), S56 (≠ N60), S72 (= S79), E200 (= E205), A204 (≠ G209), D206 (= D211), G229 (= G233), L299 (≠ I304), S300 (= S305)
- binding calcium ion: E200 (= E205), A204 (≠ G209), D206 (= D211)
- binding pyridoxal-5'-phosphate: F49 (= F53), K50 (= K54), N74 (= N81), G175 (= G180), G176 (= G181), G177 (= G182), G178 (= G183), E274 (= E278), T276 (= T280), S300 (= S305), G301 (= G306)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
40% identity, 98% coverage: 3:317/320 of query aligns to 4:321/326 of 2gn2A
- active site: K56 (= K54), A81 (≠ S79), Q207 (≠ E205), V211 (≠ G209), G213 (≠ D211), G235 (= G233), I308 (= I304), S309 (= S305)
- binding cytidine-5'-monophosphate: R51 (= R49), T52 (≠ M50), G53 (= G51), A114 (= A112), D117 (≠ G115), Y118 (= Y116), N312 (= N308)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
39% identity, 97% coverage: 6:314/320 of query aligns to 8:322/339 of Q9QZX7
- C113 (≠ A108) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
Query Sequence
>RR42_RS11110 FitnessBrowser__Cup4G11:RR42_RS11110
MLNLPTFDDVSAAAARIEGYAHRTPVMRSRTADKDVGAELFFKCENLQRMGAFKFRGAFN
AVSKFDERQRRAGVVAYSSGNHAQGIALAASILGIPATIVMPHDAPAAKVAATRGYGAKV
VIYDRYTEDREAIGRKLAEEHGLTLIPPYDHPDVIAGQGTAAKELFEETGELDALFVCLG
GGGLLSGSALSARALSPQCKIYGVEPAAGNDGQQSFRTGSIVHIETPKTIADGAQTQHLG
NYTFEIIRRDVDDIVTATDDELVDCMRFFASRMKLVVEPTGCLGFAAVRAMKAELQGKRV
GVLISGGNIDIDRFAALLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory