SitesBLAST
Comparing RR42_RS11115 FitnessBrowser__Cup4G11:RR42_RS11115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
34% identity, 97% coverage: 8:321/323 of query aligns to 4:319/320 of 1omoA
- active site: R52 (≠ K59), D219 (= D228)
- binding nicotinamide-adenine-dinucleotide: T109 (= T116), G134 (= G141), T135 (≠ V142), Q136 (= Q143), Y156 (≠ V164), D157 (≠ T165), V158 (= V166), R159 (≠ Q169), T195 (= T204), P196 (= P205), G217 (= G226), D219 (= D228), K223 (= K232), S290 (≠ M292), T291 (= T293), G292 (= G294)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
34% identity, 97% coverage: 8:321/323 of query aligns to 4:319/322 of O28608
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 93% coverage: 6:304/323 of query aligns to 2:305/322 of 6rqaB
- binding Tb-Xo4: E49 (≠ T52), D50 (≠ G53), N76 (≠ A79)
- binding nicotinamide-adenine-dinucleotide: T113 (= T116), G138 (= G141), Q140 (= Q143), P162 (≠ Q169), H163 (= H170), I199 (≠ A203), T200 (= T204), S201 (≠ P205), S202 (≠ G206), M221 (≠ V225), G222 (= G226), D224 (= D228), K228 (= K232), G293 (≠ M292), T294 (= T293), G295 (= G294)
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
32% identity, 93% coverage: 6:304/323 of query aligns to 2:305/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (= H88), T113 (= T116), G138 (= G141), H139 (≠ V142), Q140 (= Q143), N161 (≠ G168), P162 (≠ Q169), H163 (= H170), M166 (≠ A173), I199 (≠ A203), T200 (= T204), S201 (≠ P205), S202 (≠ G206), M221 (≠ V225), G222 (= G226), D224 (= D228), K228 (= K232), G293 (≠ M292)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
32% identity, 92% coverage: 7:304/323 of query aligns to 1:303/320 of A1B8Z0
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
27% identity, 97% coverage: 7:320/323 of query aligns to 1:324/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ P87), T111 (= T116), G136 (= G141), V137 (= V142), Q138 (= Q143), D159 (≠ T165), I160 (≠ V166), A199 (= A203), T200 (= T204), T201 (≠ P205), A202 (≠ G206), V206 (≠ L210), V221 (= V225), G222 (= G226), W223 (≠ A227), S296 (≠ M292), V297 (≠ T293), G298 (= G294)
- binding proline: R39 (vs. gap), M54 (≠ K59), K67 (= K72), R110 (= R115)
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
32% identity, 81% coverage: 63:323/323 of query aligns to 59:324/340 of 1x7dA
- active site: D227 (= D228)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ P87), R111 (= R115), T112 (= T116), G137 (= G141), A138 (≠ V142), Q139 (= Q143), D160 (≠ G168), T161 (≠ Q169), V200 (≠ I201), T201 (= T202), A202 (= A203), I209 (≠ L210), V224 (= V225), G225 (= G226), D227 (= D228), K231 (= K232), S292 (≠ M292), V293 (≠ T293), G294 (= G294)
- binding L-ornithine: K68 (= K72), V70 (≠ A74), N71 (≠ G75), G72 (≠ F76), R111 (= R115), D227 (= D228), V293 (≠ T293)
Sites not aligning to the query:
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
32% identity, 81% coverage: 63:323/323 of query aligns to 59:324/341 of 1u7hA
- active site: D227 (= D228)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ P87), R111 (= R115), T112 (= T116), G137 (= G141), A138 (≠ V142), Q139 (= Q143), D160 (≠ G168), T161 (≠ Q169), V200 (≠ I201), T201 (= T202), A202 (= A203), I209 (≠ L210), V224 (= V225), G225 (= G226), D227 (= D228), K231 (= K232), S292 (≠ M292), V293 (≠ T293), G294 (= G294)
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
32% identity, 81% coverage: 63:323/323 of query aligns to 60:325/350 of Q88H32
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
33% identity, 68% coverage: 88:306/323 of query aligns to 91:305/312 of 2i99A
- active site: S228 (≠ D228)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: H91 (= H88), R118 (= R115), T119 (= T116), G142 (= G139), A143 (≠ T140), G144 (= G141), V145 (= V142), Q146 (= Q143), N167 (≠ T165), R168 (≠ V166), T169 (= T167), V203 (≠ A203), T204 (= T204), L205 (≠ P205), A206 (≠ G206), V225 (= V225), G226 (= G226), S291 (≠ M292), L292 (≠ T293), G293 (= G294)
Sites not aligning to the query:
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
33% identity, 68% coverage: 88:306/323 of query aligns to 92:306/314 of Q14894
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
32% identity, 68% coverage: 86:306/323 of query aligns to 80:296/303 of 4bvaA
- active site: S219 (≠ D228)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T112), R109 (= R115), T110 (= T116), G135 (= G141), V136 (= V142), Q137 (= Q143), N158 (≠ T165), R159 (≠ V166), T160 (= T167), N163 (≠ H170), V194 (≠ A203), T195 (= T204), M196 (≠ P205), A197 (≠ G206), V216 (= V225), S282 (≠ M292), L283 (≠ T293), G284 (= G294)
- binding 3,5,3'triiodothyronine: S219 (≠ D228), R220 (≠ T229), W223 (≠ K232), E247 (≠ Q255)
Sites not aligning to the query:
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
32% identity, 68% coverage: 88:306/323 of query aligns to 83:297/303 of 4bv9A
- active site: S220 (≠ D228)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: H83 (= H88), T111 (= T116), G134 (= G139), G136 (= G141), V137 (= V142), Q138 (= Q143), N159 (≠ T165), R160 (≠ V166), T161 (= T167), V195 (≠ A203), T196 (= T204), M197 (≠ P205), A198 (≠ G206), V217 (= V225), G218 (= G226), S283 (≠ M292), L284 (≠ T293), G285 (= G294)
- binding pyruvic acid: R110 (= R115)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
34% identity, 77% coverage: 71:319/323 of query aligns to 80:332/357 of 5gzlA
- binding lysine: D240 (= D228), R267 (≠ Q255), E268 (≠ I256)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ F76), T97 (≠ H88), I98 (vs. gap), T126 (= T116), G151 (= G141), A152 (≠ V142), Q153 (= Q143), D174 (≠ V164), T175 (= T165), H179 (≠ F174), A212 (= A203), T213 (= T204), S214 (≠ P205), V222 (≠ L210), V237 (= V225), G238 (= G226), A239 (= A227), D240 (= D228), K244 (= K232), S305 (≠ M292), T306 (= T293), G307 (= G294)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
34% identity, 77% coverage: 71:319/323 of query aligns to 80:332/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ F76), T97 (≠ H88), R125 (= R115), T126 (= T116), G151 (= G141), A152 (≠ V142), Q153 (= Q143), D174 (≠ V164), T175 (= T165), H179 (≠ F174), A212 (= A203), T213 (= T204), S214 (≠ P205), V215 (vs. gap), V237 (= V225), G238 (= G226), A239 (= A227), S305 (≠ M292), T306 (= T293), G307 (= G294)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K72), R125 (= R115), A239 (= A227), T306 (= T293), G307 (= G294)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
34% identity, 77% coverage: 71:319/323 of query aligns to 76:328/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (= K72), R121 (= R115), T302 (= T293), G303 (= G294)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ F76), T93 (≠ H88), I94 (vs. gap), R121 (= R115), T122 (= T116), G147 (= G141), A148 (≠ V142), Q149 (= Q143), D170 (≠ V164), T171 (= T165), H175 (≠ F174), A208 (= A203), T209 (= T204), S210 (≠ P205), V211 (vs. gap), V218 (≠ L210), V233 (= V225), A235 (= A227), S301 (≠ M292), T302 (= T293), G303 (= G294)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
34% identity, 77% coverage: 71:319/323 of query aligns to 76:328/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ F76), T93 (≠ H88), I94 (vs. gap), T122 (= T116), G147 (= G141), A148 (≠ V142), Q149 (= Q143), D170 (≠ V164), T171 (= T165), A208 (= A203), T209 (= T204), S210 (≠ P205), V211 (vs. gap), V233 (= V225), A235 (= A227), S301 (≠ M292), T302 (= T293), G303 (= G294)
- binding proline: K77 (= K72), R121 (= R115)
Sites not aligning to the query:
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 74% coverage: 69:308/323 of query aligns to 68:319/325 of Q9FLY0
- G89 (≠ A90) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G139) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ I201) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
23% identity, 92% coverage: 25:320/323 of query aligns to 23:316/318 of 4mpdA
- active site: I53 (≠ F56), M224 (≠ D228)
- binding 2-oxoglutaric acid: K43 (≠ V46), R51 (≠ G54), M55 (≠ I58), K64 (≠ G67), I66 (≠ L69), R80 (≠ P87), M289 (≠ T293)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ P87), R108 (= R115), T109 (= T116), G134 (= G141), I136 (≠ Q143), D158 (≠ G168), Q159 (= Q169), F160 (≠ H170), T200 (= T204), V201 (≠ P205), I221 (≠ V225)
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
23% identity, 75% coverage: 78:320/323 of query aligns to 85:332/334 of 4mp6A
- active site: M236 (≠ D228)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ P87), R120 (= R115), T121 (= T116), G146 (= G141), L147 (≠ V142), I148 (≠ Q143), D170 (≠ G168), Q171 (= Q169), C211 (≠ A203), T212 (= T204), V213 (≠ P205), I233 (≠ V225), G306 (= G294)
Sites not aligning to the query:
Query Sequence
>RR42_RS11115 FitnessBrowser__Cup4G11:RR42_RS11115
MRSEARLLLLDKNQVESLLQPADAMEAVSEAFALHSEGEGRVFPLVREPLATGGVFGIKS
GDVQSQGLLGFKAAGFWPANREVGGEPHQATIMLIDPATGRPVCMIDGNAVTTMRTGAAG
GLGLQWLARQDSERLCLFGTGVQARIQLTFALALLPSLKQVQYVTVTGQHDAAFERAFAE
RCEISHAPDRNAAVAGSDVVITATPGGGALFDLQAVQPGTHLNCVGADTRGKRELPDGLL
ARARLFVDDRAQARQIGETQWAPDTPCTEIGDVLGGKVQVERHDTDITVFDMTGLALQDL
TVARLLQRRAATAQAGTSIHWPW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory