Comparing RR42_RS11230 FitnessBrowser__Cup4G11:RR42_RS11230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
39% identity, 92% coverage: 16:335/347 of query aligns to 4:323/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 92% coverage: 16:333/347 of query aligns to 3:310/310 of 4fwiB
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 90% coverage: 15:328/347 of query aligns to 2:321/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
38% identity, 74% coverage: 14:270/347 of query aligns to 1:247/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
38% identity, 74% coverage: 14:270/347 of query aligns to 1:247/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
38% identity, 74% coverage: 14:270/347 of query aligns to 1:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 73% coverage: 16:269/347 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 73% coverage: 16:269/347 of query aligns to 2:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 73% coverage: 16:269/347 of query aligns to 2:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 73% coverage: 16:269/347 of query aligns to 2:244/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 73% coverage: 15:267/347 of query aligns to 1:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 73% coverage: 16:270/347 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 73% coverage: 16:270/347 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 73% coverage: 16:270/347 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 73% coverage: 16:270/347 of query aligns to 3:241/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 73% coverage: 16:270/347 of query aligns to 1:239/240 of 4ymuJ
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 60% coverage: 35:243/347 of query aligns to 20:221/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 60% coverage: 35:243/347 of query aligns to 20:221/230 of 1l2tA
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
31% identity, 70% coverage: 17:258/347 of query aligns to 11:243/257 of P0AAH0
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 68% coverage: 16:250/347 of query aligns to 3:222/229 of 6z67B
>RR42_RS11230 FitnessBrowser__Cup4G11:RR42_RS11230
MTTTMSRVALPTGEPLLEVDDLHTHFDTLTGPARSVNGVSYTVRAGQTLGVVGESGCGKS
VTALSIMRLLPTPPARMRGAVRLRGIDLLQLSEREMRRIRGNRVSMIFQEPMTSLNPVLT
IGRQIAETVQLHQGASRADALKRAAEMLRLVQIPEPERRVNEYPHQLSGGMRQRVMIALA
LACNPEVLIADEPTTALDVTIQAQILDLIRRLQKELGMGVVMITHDLGVVAECCDRVIVM
YAGRKVEEASVIDLFDRPLHPYTRALMASMPSMNTSSQRLAEIPGLVPSPQQARRGCAFA
ARCPHADTRCAREIPQLTRHGADHAVACFAVEEGRIECNQPAQEAIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory