Comparing RR42_RS11235 FitnessBrowser__Cup4G11:RR42_RS11235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 97% coverage: 9:329/330 of query aligns to 1:307/310 of 4fwiB
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
35% identity, 97% coverage: 9:329/330 of query aligns to 2:318/326 of Q8RDH4
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
33% identity, 97% coverage: 10:329/330 of query aligns to 2:323/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 78% coverage: 10:265/330 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 78% coverage: 10:265/330 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 78% coverage: 10:265/330 of query aligns to 2:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 77% coverage: 35:289/330 of query aligns to 18:267/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 77% coverage: 35:289/330 of query aligns to 19:268/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 77% coverage: 35:289/330 of query aligns to 19:268/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 77% coverage: 35:289/330 of query aligns to 19:268/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 78% coverage: 10:265/330 of query aligns to 1:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 70% coverage: 35:265/330 of query aligns to 14:239/240 of 4ymuJ
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
39% identity, 65% coverage: 35:249/330 of query aligns to 21:216/218 of 7w78A
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
39% identity, 65% coverage: 35:249/330 of query aligns to 21:216/216 of 7w79A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
28% identity, 80% coverage: 24:287/330 of query aligns to 28:287/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
28% identity, 80% coverage: 24:287/330 of query aligns to 28:287/382 of 7aheC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 71% coverage: 41:275/330 of query aligns to 36:261/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 68% coverage: 31:253/330 of query aligns to 14:232/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 68% coverage: 31:253/330 of query aligns to 14:232/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 68% coverage: 31:253/330 of query aligns to 14:232/353 of 1oxuA
Sites not aligning to the query:
>RR42_RS11235 FitnessBrowser__Cup4G11:RR42_RS11235
MSTPTVPPSPLLKVDRLKKHYIAPQRWLAPRKPPIQAVDGVSFTVERGETLSLVGESGCG
KTTTAKSVLRLVEPTSGSVQLDGEELLGLSANAMRLRRRDLQIIFQDPYASLSPRLTAGE
IVSEPLRNFGMRSRTERSERVQWLFAKVGLRPEAARKFPHEFSGGQRQRLGIARALALNP
KLIVCDEPVSALDVSVQAQVVNLLMDLQAELGIAYLFVAHDLAVVRHISHRVAVMYLGQI
VELADRDTLFSAPRHPYTEILLSAVPVPNPRTPARRLLLQGDPPSPANPPPGCRFHTRCP
LAQAICKEQAPALTERPSAGGGHQVACHFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory