Comparing RR42_RS12000 FitnessBrowser__Cup4G11:RR42_RS12000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
62% identity, 100% coverage: 1:316/317 of query aligns to 1:311/321 of P37595
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
63% identity, 48% coverage: 5:157/317 of query aligns to 4:156/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
63% identity, 48% coverage: 5:157/317 of query aligns to 4:156/156 of 8c0iAAA
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
40% identity, 97% coverage: 1:309/317 of query aligns to 1:292/308 of Q7L266
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
66% identity, 42% coverage: 185:316/317 of query aligns to 1:133/135 of 2zalB
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
39% identity, 97% coverage: 1:309/317 of query aligns to 2:282/298 of 4pvrA
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
39% identity, 97% coverage: 1:309/317 of query aligns to 2:284/300 of 4osxA
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
66% identity, 42% coverage: 185:316/317 of query aligns to 1:133/135 of 8c23DDD
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
38% identity, 97% coverage: 1:309/317 of query aligns to 2:279/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
38% identity, 94% coverage: 4:300/317 of query aligns to 4:273/298 of 4o48A
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
37% identity, 85% coverage: 21:289/317 of query aligns to 4:264/295 of 1p4vA
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
36% identity, 86% coverage: 17:289/317 of query aligns to 45:309/340 of Q47898
Sites not aligning to the query:
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
36% identity, 85% coverage: 21:289/317 of query aligns to 2:262/293 of 4r4yA
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
55% identity, 38% coverage: 185:305/317 of query aligns to 1:119/133 of 2gezB
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
51% identity, 38% coverage: 185:305/317 of query aligns to 1:119/131 of 4pu6B
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
32% identity, 79% coverage: 6:255/317 of query aligns to 44:311/420 of Q9H6P5
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
44% identity, 44% coverage: 6:146/317 of query aligns to 5:143/158 of 4pv2C
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
40% identity, 48% coverage: 6:156/317 of query aligns to 5:154/166 of 2gezC
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
31% identity, 79% coverage: 6:255/317 of query aligns to 4:218/313 of 2a8jB
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
32% identity, 74% coverage: 21:255/317 of query aligns to 25:277/346 of P20933
Sites not aligning to the query:
>RR42_RS12000 FitnessBrowser__Cup4G11:RR42_RS12000
MNTPVIAIHGGAGTITRAAMSPAKQAEYTAALSAVLEAGQRVLADGGSALDAVTEAVRLL
EDCPLFNAGRGSVLTHAGTYELDAAIMDGATLGAGAVACVKHLRNPVLAARAVMEKSQHV
LFAGEGAEAFAQAQGLELVTPDYYFTQARTDQWERARAGSGTTLLDHDAATLAAEPIDPD
TKFGTVGAVAFDAQGRLAAATSTGGVTNKQVGRVGDTPIVGAGCFADDVAAVSATGTGEM
FIRTVAAYDVAAQMRYAGVPLEEAARRVVMEKLPAIEGRGGLIAVDREGNVTLPFNTEGM
YRGFARVGEPVNVWIYG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory