Comparing RR42_RS12215 FitnessBrowser__Cup4G11:RR42_RS12215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
44% identity, 79% coverage: 28:158/165 of query aligns to 25:155/156 of 1nxjA
Sites not aligning to the query:
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
39% identity, 99% coverage: 2:164/165 of query aligns to 1:158/158 of 2yjvC
>RR42_RS12215 FitnessBrowser__Cup4G11:RR42_RS12215
MSFATTDLCDANEARLADGSLRVLSPVFQHFGKRAAFSGPAATLKVFEDNSLVRETVESP
GNGRVLVVDGGGSLRCALVGGNLGVLAEKNGWVGILVNGCVRDSGELAVCDIGVRALALH
PQKSQKRNVGEREVTVQMPGAVVRPGNWIYADADGVLVADTRLEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory