Comparing RR42_RS12425 FitnessBrowser__Cup4G11:RR42_RS12425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
40% identity, 87% coverage: 13:295/326 of query aligns to 9:288/305 of 6ndsA
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
36% identity, 86% coverage: 2:281/326 of query aligns to 68:345/370 of Q8TB92
Sites not aligning to the query:
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
35% identity, 90% coverage: 2:295/326 of query aligns to 23:314/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
35% identity, 88% coverage: 9:295/326 of query aligns to 3:287/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
35% identity, 88% coverage: 9:295/326 of query aligns to 3:287/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
35% identity, 88% coverage: 9:295/326 of query aligns to 3:287/296 of 3mp5B
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
38% identity, 86% coverage: 14:293/326 of query aligns to 6:278/283 of 1ydnA
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
39% identity, 86% coverage: 11:291/326 of query aligns to 2:281/301 of P13703
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
28% identity, 95% coverage: 9:318/326 of query aligns to 14:303/399 of 6ktqA
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
36% identity, 30% coverage: 148:245/326 of query aligns to 159:255/418 of Q9Y823
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
36% identity, 30% coverage: 148:245/326 of query aligns to 154:250/400 of 3ivtB
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
36% identity, 30% coverage: 148:245/326 of query aligns to 125:221/370 of 3mi3A
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
36% identity, 30% coverage: 148:245/326 of query aligns to 123:219/364 of 3ivsA
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
25% identity, 54% coverage: 107:281/326 of query aligns to 99:266/308 of 3rmjB
Sites not aligning to the query:
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
25% identity, 54% coverage: 107:281/326 of query aligns to 102:269/517 of Q9JZG1
Sites not aligning to the query:
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
28% identity, 72% coverage: 10:245/326 of query aligns to 2:226/376 of O87198
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 58% coverage: 103:290/326 of query aligns to 185:368/506 of Q9FG67
Sites not aligning to the query:
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
27% identity, 72% coverage: 10:245/326 of query aligns to 2:220/314 of 2zyfA
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
35% identity, 42% coverage: 152:289/326 of query aligns to 138:270/347 of Q53WI0
Sites not aligning to the query:
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
27% identity, 72% coverage: 10:245/326 of query aligns to 1:219/347 of 3a9iA
>RR42_RS12425 FitnessBrowser__Cup4G11:RR42_RS12425
MTTHIPSAPRQAVIREVGLRDGLQSIATILPTSAKREWIQAAYAAGQREIEVGSFVPAKL
LPQLADTAELVDFARSLPGLFVSVLVPNLRGAQNAIASGADLMLVPLSASHAHSLANLRK
TPDEVVAEVARIRAERDAAGSRTLIEGGVGTAFGCTIQGHVDPEEVLRLMQALLDAGADR
VSLADTVGYADPGMVRRLFERATALAGDRFWCGHFHDTRGLGLANVHAALEAGVTRFDAC
LAGIGGCPHAPGASGNVATEDLAYLLGSMGFDTGIDIGRLLALRERVAGWLTNETLHGTL
WRAGLPKTFPASVADAAFRLRENHGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory