Comparing RR42_RS12535 FitnessBrowser__Cup4G11:RR42_RS12535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
43% identity, 100% coverage: 1:480/482 of query aligns to 2:462/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
40% identity, 91% coverage: 3:443/482 of query aligns to 7:461/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 92% coverage: 1:443/482 of query aligns to 5:464/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
34% identity, 100% coverage: 1:482/482 of query aligns to 5:496/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
29% identity, 99% coverage: 1:479/482 of query aligns to 1:427/428 of 1vb3A
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
28% identity, 37% coverage: 99:275/482 of query aligns to 33:191/345 of 6cgqB
Sites not aligning to the query:
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
28% identity, 37% coverage: 99:275/482 of query aligns to 35:193/350 of 6nmxA
Sites not aligning to the query:
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
27% identity, 37% coverage: 99:275/482 of query aligns to 31:183/339 of 6cgqA
Sites not aligning to the query:
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 35% coverage: 109:275/482 of query aligns to 56:203/360 of A0R220
>RR42_RS12535 FitnessBrowser__Cup4G11:RR42_RS12535
MKYQSTRGHEMPQTFSEILLGGLAPDGGLYLPREYPQVTADELEAWRKLSYADLAFEVLS
RFCDDIPAEDLRALTRKTYTAEVYCNARPGDNTADITPLRTLGEEGGTQLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALARAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDLGYKARQKIGTVNSINWARVV
AQVVYYFKGWLLATDGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGRDGDKLAKMFREDVDTKGG
FDLSGTPEFERIRAFGFVSGRSTHEDRLATIRDLSERYGITIDTHTADGIKVAREHLTPG
VPMLVLETALPAKFADTIRAALGHEPERPAAFEGIENLPQRFEVMPADADRIKAYIAGHT
GL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory