Comparing RR42_RS12610 FitnessBrowser__Cup4G11:RR42_RS12610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5k45A Wolinella succinogenes l-asparaginase p121 + l-glutamic acid (see paper)
43% identity, 98% coverage: 5:330/332 of query aligns to 2:326/328 of 5k45A
5k3oA Wolinella succinogenes l-asparaginase p121 and l-aspartic acid (see paper)
43% identity, 98% coverage: 5:330/332 of query aligns to 2:326/328 of 5k3oA
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
40% identity, 99% coverage: 4:331/332 of query aligns to 1:306/307 of 1jazA
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
40% identity, 99% coverage: 4:331/332 of query aligns to 1:305/306 of 7r5qA
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
42% identity, 99% coverage: 4:331/332 of query aligns to 23:347/348 of P00805
Sites not aligning to the query:
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
41% identity, 99% coverage: 4:331/332 of query aligns to 1:325/326 of 1ho3A
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
40% identity, 99% coverage: 4:331/332 of query aligns to 1:325/326 of 2wltA
1jsrA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-l-norleucine (see paper)
39% identity, 98% coverage: 4:329/332 of query aligns to 1:321/324 of 1jsrA
1jslA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-d-norleucine (see paper)
39% identity, 98% coverage: 4:329/332 of query aligns to 1:321/324 of 1jslA
P06608 L-asparaginase; L-ASNase; L-asparagine amidohydrolase; EC 3.5.1.1 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see 2 papers)
39% identity, 98% coverage: 4:329/332 of query aligns to 25:345/348 of P06608
1hg0A X-ray structure of the complex between erwinia chrysanthemi l- asparaginase and succinic acid (see paper)
39% identity, 98% coverage: 4:329/332 of query aligns to 4:324/327 of 1hg0A
7u6mC Albumin binding domain fused to a mutant of the erwinia asparaginase (see paper)
38% identity, 98% coverage: 4:329/332 of query aligns to 19:339/342 of 7u6mC
6pa3A E. Coli l-asparaginase ii double mutant (t89v,k162t) in complex with l-asn at ph 7.0 (see paper)
41% identity, 99% coverage: 4:331/332 of query aligns to 9:333/334 of 6pa3A
Sites not aligning to the query:
2gvnA L-asparaginase from erwinia carotovora in complex with aspartic acid (see paper)
38% identity, 98% coverage: 4:329/332 of query aligns to 2:322/325 of 2gvnA
1hfwA X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and l-glutamate (see paper)
38% identity, 98% coverage: 4:329/332 of query aligns to 2:304/307 of 1hfwA
6wywA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-asp at ph 4.5
40% identity, 99% coverage: 4:331/332 of query aligns to 1:316/317 of 6wywA
1hg1A X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and d-aspartate (see paper)
38% identity, 98% coverage: 4:329/332 of query aligns to 1:303/306 of 1hg1A
6wyyA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-glu at ph 6.5
39% identity, 99% coverage: 4:331/332 of query aligns to 2:314/315 of 6wyyA
6wyzA Crystal structure of pseudomonas 7a glutaminase-asparaginase (mutant k173m) in complex with d-glu at ph 5.5
39% identity, 99% coverage: 4:331/332 of query aligns to 1:311/312 of 6wyzA
2hlnA L-asparaginase from erwinia carotovora in complex with glutamic acid (see paper)
38% identity, 98% coverage: 4:329/332 of query aligns to 2:305/308 of 2hlnA
>RR42_RS12610 FitnessBrowser__Cup4G11:RR42_RS12610
MSLLPRVVVLATGGTIAGSSSNPASSAKYQAATVPVTALLDAVPALGAVARIEAEQLAQV
DSKDMSFALWSRLVERVAFWSAQPDVSGIVITHGTDTLEETAMLLHLACVGTVPVVLTAA
MRPSTSLSADGPLNLLDAVRVAADAGATAKGVLLVINQEIHAGRDVMKAHTSAVNAFVSP
VSGPIGFVQDNLVRFVRTPSRLPAKAWPVPGAWPQVEIVASYAEPGRIVVDALAQAGVSG
LVVAAAGNGSVHQSLVEALTDAAGAGVAVVRSSRTGAGHVAIPAPPRPAAGVFVSAGDLN
PYKARVLLALALAAEPGLAKDPAALQALFTEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory