SitesBLAST
Comparing RR42_RS13475 FitnessBrowser__Cup4G11:RR42_RS13475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
59% identity, 100% coverage: 2:448/448 of query aligns to 3:444/445 of P31120
- S100 (= S105) mutation to A: 2% of wild-type activity.; mutation to T: 20-fold increase in the non-specific phosphoglucomutase activity towards glucose-phosphate substrates (non aminated).
- S102 (= S107) active site, Phosphoserine intermediate; modified: Phosphoserine; by autocatalysis; mutation to A: Loss of activity in the absence or presence of glucosamine-1,6-diP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
43% identity, 99% coverage: 4:448/448 of query aligns to 2:442/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
43% identity, 99% coverage: 4:448/448 of query aligns to 2:442/445 of 7ojrA
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
42% identity, 99% coverage: 4:447/448 of query aligns to 1:437/441 of 3i3wA
- active site: R9 (= R12), S99 (= S107), H100 (= H108), K109 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H334)
- binding zinc ion: S99 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
34% identity, 97% coverage: 4:437/448 of query aligns to 3:441/455 of 1wqaA
- active site: R11 (= R12), S101 (= S107), H102 (= H108), K111 (= K117), D243 (= D246), D245 (= D248), D247 (= D250), R248 (= R251), G330 (≠ H334), R340 (≠ G344)
- binding magnesium ion: S101 (= S107), D243 (= D246), D245 (= D248), D247 (= D250)
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 11:446/455 of 2h5aX
- active site: H101 (= H108), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), D332 (≠ G344)
- binding 1-O-phosphono-alpha-D-xylopyranose: T298 (≠ V311), G299 (= G312), H300 (≠ D313), E317 (= E330), S319 (= S332), H321 (= H334), R413 (= R415), S415 (= S417), N416 (≠ G418), T417 (= T419)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 11:446/455 of 2h4lX
- active site: H101 (= H108), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), D332 (≠ G344)
- binding 1-O-phosphono-alpha-D-ribofuranose: R12 (= R12), S100 (= S107), T298 (≠ V311), E317 (= E330), R413 (= R415), S415 (= S417), N416 (≠ G418), T417 (= T419)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 11:446/455 of 2fkfA
- active site: R12 (= R12), S100 (= S107), H101 (= H108), K110 (= K117), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), H321 (= H334), D332 (≠ G344)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: H101 (= H108), S319 (= S332), R413 (= R415), S415 (= S417), N416 (≠ G418), T417 (= T419)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 11:446/455 of 1pcmX
- active site: R12 (= R12), S100 (= S107), H101 (= H108), K110 (= K117), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), H321 (= H334), D332 (≠ G344)
- binding 6-O-phosphono-alpha-D-mannopyranose: S100 (= S107), T298 (≠ V311), G299 (= G312), H300 (≠ D313), E317 (= E330), S319 (= S332), H321 (= H334), R413 (= R415), S415 (= S417)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 11:446/455 of 1p5gX
- active site: R12 (= R12), S100 (= S107), H101 (= H108), K110 (= K117), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), H321 (= H334), D332 (≠ G344)
- binding 6-O-phosphono-alpha-D-glucopyranose: S100 (= S107), K277 (≠ L289), G299 (= G312), H300 (≠ D313), E317 (= E330), S319 (= S332), H321 (= H334), R413 (= R415), S415 (= S417), N416 (≠ G418), T417 (= T419)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 11:446/455 of 1p5dX
- active site: R12 (= R12), S100 (= S107), H101 (= H108), K110 (= K117), D234 (= D246), D236 (= D248), D238 (= D250), R239 (= R251), H321 (= H334), D332 (≠ G344)
- binding 1-O-phosphono-alpha-D-glucopyranose: S100 (= S107), R239 (= R251), T298 (≠ V311), G299 (= G312), H300 (≠ D313), E317 (= E330), S319 (= S332), H321 (= H334), R413 (= R415), S415 (= S417), T417 (= T419)
- binding zinc ion: S100 (= S107), D234 (= D246), D236 (= D248), D238 (= D250)
Sites not aligning to the query:
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 14:449/458 of 1pcjX
- active site: R15 (= R12), S103 (= S107), H104 (= H108), K113 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H334), D335 (≠ G344)
- binding 1-O-phosphono-alpha-D-mannopyranose: S103 (= S107), T301 (≠ V311), G302 (= G312), E320 (= E330), S322 (= S332), H324 (= H334), R416 (= R415), S418 (= S417), N419 (≠ G418), T420 (= T419)
- binding zinc ion: S103 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
Sites not aligning to the query:
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
29% identity, 98% coverage: 11:448/448 of query aligns to 19:454/463 of P26276
- R20 (= R12) mutation to A: No phosphoglucomutase activity.
- S108 (= S107) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N109) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D246) binding
- D244 (= D248) binding
- D246 (= D250) binding
- R247 (= R251) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ E266) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (≠ L289) binding
- H308 (≠ D313) binding ; binding
- E325 (= E330) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ EGSGH 330:334) binding ; binding
- H329 (= H334) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (= P375) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R415) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RASGT 415:419) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 15 R→A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- 17 binding ; binding
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 19:454/463 of Q02E40
- S108 (= S107) active site, Non-phosphorylated intermediate; modified: Phosphoserine
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 15:450/459 of 1k2yX
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
29% identity, 98% coverage: 11:448/448 of query aligns to 15:450/459 of 4il8A
- active site: R16 (= R12), S104 (= S107), H105 (= H108), K114 (= K117), D238 (= D246), D240 (= D248), D242 (= D250), R243 (= R251), A325 (≠ H334), D336 (≠ G344)
- binding magnesium ion: S104 (= S107), D238 (= D246), D240 (= D248), D242 (= D250)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
29% identity, 100% coverage: 1:447/448 of query aligns to 1:447/448 of 6nqhA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H334)
- binding magnesium ion: D237 (= D246), D239 (= D248), D241 (= D250)
- binding 1-O-phosphono-alpha-D-xylopyranose: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D239 (= D248), R242 (= R251), R280 (≠ L289), S301 (≠ V311), G302 (= G312), E320 (= E330), S322 (= S332), H324 (= H334), R414 (= R415), S416 (= S417), N417 (≠ G418), T418 (= T419), R423 (= R424)
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
29% identity, 100% coverage: 1:447/448 of query aligns to 1:447/448 of 6np8A
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H334)
- binding calcium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (≠ D9), R280 (≠ L289), G302 (= G312), H303 (≠ D313), E320 (= E330), S322 (= S332), H324 (= H334), R414 (= R415), S416 (= S417), N417 (≠ G418), T418 (= T419), R423 (= R424)
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
29% identity, 100% coverage: 1:447/448 of query aligns to 1:447/448 of 6nolA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H334)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G312), E320 (= E330), S322 (= S332), H324 (= H334), R414 (= R415), S416 (= S417), N417 (≠ G418), T418 (= T419), R423 (= R424)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
29% identity, 100% coverage: 1:447/448 of query aligns to 1:447/448 of 6nnpA
- active site: R12 (= R12), S97 (= S107), H98 (= H108), K107 (= K117), D237 (= D246), D239 (= D248), D241 (= D250), R242 (= R251), H324 (= H334)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ L289), G302 (= G312), H303 (≠ D313), E320 (= E330), H324 (= H334), R414 (= R415), S416 (= S417), N417 (≠ G418), T418 (= T419), R423 (= R424)
- binding magnesium ion: S97 (= S107), D237 (= D246), D239 (= D248), D241 (= D250)
Query Sequence
>RR42_RS13475 FitnessBrowser__Cup4G11:RR42_RS13475
MTRKYFGTDGIRGRVGEAPITPDFVMRLGYAAGMVLAHGAKQHDQARPTVLIGKDTRISG
YMLEAALEAGFTSAGVNVLLTGPLPTPGVAYLTRALRLSAGVVISASHNPYYDNGIKFFS
ADGDKLPDAVEMAIEQALEEPMVCVRSDDLGRARRIEDAAGRYIEFCKSTFPYEQDLHKL
KLVVDCAHGAAYHIAPHVFHELGADVISIGNQPDGRNINAGYGATAPEKLIEAVKANGAD
LGLAFDGDADRLQVVDRDGRLFNGDELLYLIVQDRLQAGQAVEGAVGTLMTNMAVELAFQ
RQGVEFVRAKVGDRYVLEELNKRKWTLGGEGSGHLLCLDRHTTGDGIVSALQVLAALRRS
GKTLSQLLEGVSLFPQTLINVRVEKGFDWQSHAGLSAARAVIEPQLAGRGRVLIRASGTE
PVVRVMVEAEKVETAEQAAQTLADALRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory