Comparing RR42_RS13570 FitnessBrowser__Cup4G11:RR42_RS13570 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
48% identity, 100% coverage: 1:266/267 of query aligns to 2:259/259 of 8ewoA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 99% coverage: 2:266/267 of query aligns to 71:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
41% identity, 99% coverage: 2:266/267 of query aligns to 1:254/254 of 2q42A
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
41% identity, 99% coverage: 2:266/267 of query aligns to 2:252/252 of 2qedA
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 99% coverage: 2:266/267 of query aligns to 1:251/251 of Q8ZRM2
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
39% identity, 100% coverage: 2:267/267 of query aligns to 1:256/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
39% identity, 100% coverage: 2:267/267 of query aligns to 1:256/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
39% identity, 100% coverage: 2:267/267 of query aligns to 1:256/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
39% identity, 100% coverage: 2:267/267 of query aligns to 49:304/308 of Q16775
6rz0A Crystal structure of escherichia coli glyoxalase ii
40% identity, 99% coverage: 2:266/267 of query aligns to 1:251/251 of 6rz0A
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 91% coverage: 2:245/267 of query aligns to 1:241/258 of O24496
Sites not aligning to the query:
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
33% identity, 88% coverage: 2:236/267 of query aligns to 13:263/283 of 2p18A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
32% identity, 63% coverage: 10:178/267 of query aligns to 11:184/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
32% identity, 63% coverage: 10:178/267 of query aligns to 9:182/198 of 2zziA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
33% identity, 68% coverage: 13:193/267 of query aligns to 37:213/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
33% identity, 68% coverage: 13:193/267 of query aligns to 21:197/237 of 4chlB
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
28% identity, 63% coverage: 12:178/267 of query aligns to 13:185/202 of 7l0bA
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
32% identity, 61% coverage: 38:199/267 of query aligns to 42:191/225 of 4ysbA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
32% identity, 55% coverage: 3:149/267 of query aligns to 4:160/210 of 2xf4A
Sites not aligning to the query:
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
28% identity, 67% coverage: 1:178/267 of query aligns to 1:191/209 of 7ev5A
>RR42_RS13570 FitnessBrowser__Cup4G11:RR42_RS13570
MLKVEPIPAFQDNYIWAIHDGHCAAVVDPGESAPVEAFLAREGLTLGAIVITHHHGDHQG
GVAGLLAVHPTAPDGAPLPVIGPAGERIGARTVAVREGDTVNVAHPSLQLKVLDVPGHTA
GHVAYVADLPGAGPSVFCGDTLFASGCGRLFEGSPAQMLSSLDKLAALPGATRVYCAHEY
TRSNVRFARAVEPHNAELAAWEARVDALRAVGAPTVPTTIGQEREVNPFLRSRVPAVREA
VAAHAGGVAGNDAAAFGALRGWKDDFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory