SitesBLAST
Comparing RR42_RS14360 FitnessBrowser__Cup4G11:RR42_RS14360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
74% identity, 96% coverage: 9:390/397 of query aligns to 1:382/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H89), K82 (= K90), Q109 (= Q117), S185 (≠ T193), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), E345 (= E353), S371 (= S379), G372 (= G380)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
64% identity, 97% coverage: 11:394/397 of query aligns to 3:386/388 of 5dw0A
- active site: K82 (= K90), E104 (= E112), S371 (= S379)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (≠ T193), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), D300 (= D308), E345 (= E353), S371 (= S379)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
64% identity, 97% coverage: 11:394/397 of query aligns to 3:386/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
64% identity, 97% coverage: 11:394/397 of query aligns to 3:386/386 of 1v8zA
- active site: K82 (= K90), E104 (= E112), S371 (= S379)
- binding pyridoxal-5'-phosphate: H81 (= H89), K82 (= K90), Q109 (= Q117), S185 (≠ T193), G227 (= G235), G228 (= G236), G229 (= G237), S230 (= S238), N231 (= N239), E345 (= E353), S371 (= S379), G372 (= G380)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
64% identity, 97% coverage: 11:397/397 of query aligns to 3:387/394 of 5ixjD
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
63% identity, 96% coverage: 11:393/397 of query aligns to 3:385/385 of 6am8B
- active site: K82 (= K90), E104 (= E112), S371 (= S379)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H89), K82 (= K90), E104 (= E112), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), L161 (= L169), S185 (≠ T193), V187 (≠ A195), G227 (= G235), G228 (= G236), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), Y301 (= Y309), E345 (= E353), S371 (= S379), G372 (= G380)
- binding tryptophan: P12 (≠ S20), L169 (≠ M177), S274 (≠ L282), H275 (= H283)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
64% identity, 96% coverage: 11:393/397 of query aligns to 3:383/383 of 5t6mA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
64% identity, 95% coverage: 11:389/397 of query aligns to 3:380/383 of 5dw3A
- active site: K82 (= K90), E104 (= E112), S370 (= S379)
- binding tryptophan: K82 (= K90), E104 (= E112), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (≠ T193), G228 (= G236), Y300 (= Y309)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
64% identity, 95% coverage: 11:389/397 of query aligns to 3:381/384 of 7rnpA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
63% identity, 96% coverage: 11:393/397 of query aligns to 3:383/383 of 5vm5D
- active site: K82 (= K90), E104 (= E112), S369 (= S379)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (≠ T193), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), G296 (= G306), E343 (= E353), S369 (= S379)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
63% identity, 96% coverage: 11:393/397 of query aligns to 3:385/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (≠ T193), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), E345 (= E353), S371 (= S379)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
64% identity, 95% coverage: 11:389/397 of query aligns to 3:381/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (≠ T193), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), E345 (= E353), S371 (= S379)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
62% identity, 98% coverage: 5:395/397 of query aligns to 5:398/399 of 5ocwB
- active site: K93 (= K90), E115 (= E112), S382 (= S379)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H89), K93 (= K90), T116 (= T113), G117 (= G114), A118 (= A115), Q120 (= Q117), H121 (= H118), T196 (= T193), G238 (= G235), G240 (= G237), S241 (= S238), N242 (= N239), G309 (= G306), E356 (= E353), S382 (= S379)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
62% identity, 98% coverage: 5:395/397 of query aligns to 9:402/405 of 6uapB
- active site: K97 (= K90), E119 (= E112), S386 (= S379)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ L173), N181 (= N174), F184 (≠ M177), Y196 (= Y189), F198 (≠ I191), P204 (= P197), F207 (≠ Y200), H290 (= H283)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
62% identity, 98% coverage: 5:395/397 of query aligns to 10:403/406 of 5tciH
- active site: K98 (= K90), E120 (= E112), S387 (= S379)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ S20), L31 (= L23), Y197 (= Y189), F199 (≠ I191), P205 (= P197), F208 (≠ Y200), H291 (= H283)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
62% identity, 98% coverage: 5:395/397 of query aligns to 10:403/405 of 6u6cB
- active site: K98 (= K90), E120 (= E112), S387 (= S379)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H89), K98 (= K90), T121 (= T113), G122 (= G114), A123 (= A115), Q125 (= Q117), H126 (= H118), T201 (= T193), G243 (= G235), G245 (= G237), S246 (= S238), N247 (= N239), G314 (= G306), E361 (= E353), S387 (= S379)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F18), F185 (≠ M177), W188 (= W180), Y197 (= Y189), F199 (≠ I191), G204 (= G196), P205 (= P197), H291 (= H283), G292 (= G284)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
62% identity, 98% coverage: 5:395/397 of query aligns to 9:402/404 of 6usaB
- active site: K97 (= K90), E119 (= E112), S386 (= S379)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H89), K97 (= K90), T120 (= T113), G121 (= G114), A122 (= A115), G123 (= G116), Q124 (= Q117), H125 (= H118), T200 (= T193), G242 (= G235), G244 (= G237), S245 (= S238), N246 (= N239), G313 (= G306), E360 (= E353), S386 (= S379)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ M177), W187 (= W180), Y196 (= Y189), F198 (≠ I191), G203 (= G196), P204 (= P197), F207 (≠ Y200), H290 (= H283), G291 (= G284)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
62% identity, 98% coverage: 5:395/397 of query aligns to 9:402/404 of 6dweB
- active site: K97 (= K90), E119 (= E112), S386 (= S379)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ M177), Y196 (= Y189), F198 (≠ I191), P204 (= P197), F207 (≠ Y200), H290 (= H283)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H89), K97 (= K90), T120 (= T113), G121 (= G114), A122 (= A115), G123 (= G116), Q124 (= Q117), H125 (= H118), T200 (= T193), G242 (= G235), G244 (= G237), S245 (= S238), N246 (= N239), G313 (= G306), E360 (= E353), S386 (= S379)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
63% identity, 96% coverage: 8:389/397 of query aligns to 1:377/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (≠ T193), G229 (= G237), S230 (= S238), N231 (= N239), G297 (= G306), E344 (= E353), S367 (= S379)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
63% identity, 96% coverage: 9:389/397 of query aligns to 1:376/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H89), K81 (= K90), T104 (= T113), G105 (= G114), A106 (= A115), Q108 (= Q117), H109 (= H118), S184 (≠ T193), G228 (= G237), S229 (= S238), N230 (= N239), G296 (= G306), E343 (= E353), S366 (= S379), G367 (= G380)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L169), I164 (≠ L173), Y180 (= Y189), P182 (≠ I191), G183 (= G192), S184 (≠ T193), V186 (≠ A195), Y299 (= Y309)
Query Sequence
>RR42_RS14360 FitnessBrowser__Cup4G11:RR42_RS14360
MYDLPDSRGHFGPYGGSFVSETLVHALDELREAYAHFQKDPEFDAEYRRELKHFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGSEDVKRQAANVYRMKLLGATVVPVESGSKTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQCVIGEEAKVQMPEMTGRQPDAVIACVGGGSNA
MGIFYPYIEHKDVRLIGVEAAGDGLETGRHAAALIGGTPGVLHGNRTYLLQDANGQIIET
HSISAGLDYPGVGPEHAWLKDIGRAEYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
ACKLAPTLPKDKLLLVNLSGRGDKDMHTVAERSGLTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory