Comparing RR42_RS14365 FitnessBrowser__Cup4G11:RR42_RS14365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
42% identity, 92% coverage: 14:228/233 of query aligns to 2:203/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
40% identity, 92% coverage: 14:228/233 of query aligns to 2:192/194 of 1lbmA
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
34% identity, 91% coverage: 17:229/233 of query aligns to 258:451/452 of 1piiA
Sites not aligning to the query:
>RR42_RS14365 FitnessBrowser__Cup4G11:RR42_RS14365
MTLLPEAGSVPRRTRIKICGLTREEDVRAAVDAGADAIGLVFYPGSPRFVEVARAAALAE
AAGPFVSVVGLFVNAEADHIAHVVERVPLTLLQFHGDERPEDCTLVAQRCRLPFLRAARV
QPGLDLVEFADLHRDAAALLLDAFVEGYGGGGHVFDWTLIPPTWLAPTHNPTASAAPRIV
LSGGLNAQNVAGAIERVRPYAVDVSSGVEAAKGVKDHARIAAFVRAVRSADAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory