SitesBLAST
Comparing RR42_RS14595 FitnessBrowser__Cup4G11:RR42_RS14595 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
47% identity, 98% coverage: 1:386/395 of query aligns to 4:395/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I17), R23 (= R18), G39 (= G34), G40 (= G35), G99 (= G94), S100 (= S95), Q101 (= Q96), Y125 (= Y120), N174 (= N168), D202 (= D196), Y205 (= Y199), S235 (= S225), S237 (= S227), K238 (= K228), R245 (= R235), R368 (= R359)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
47% identity, 98% coverage: 1:386/395 of query aligns to 4:395/397 of Q72LL6
- S20 (= S15) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R18) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G35) binding
- Y70 (= Y65) binding
- N174 (= N168) binding ; binding
- R245 (= R235) binding
- R368 (= R359) binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
48% identity, 97% coverage: 2:386/395 of query aligns to 1:391/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I17), R19 (= R18), G35 (= G34), G36 (= G35), G95 (= G94), S96 (= S95), Q97 (= Q96), Y121 (= Y120), N170 (= N168), D198 (= D196), Y201 (= Y199), S231 (= S225), S233 (= S227), K234 (= K228), R241 (= R235), R364 (= R359)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
48% identity, 97% coverage: 2:386/395 of query aligns to 1:391/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G94), S96 (= S95), Q97 (= Q96), Y121 (= Y120), N170 (= N168), D198 (= D196), A200 (≠ P198), Y201 (= Y199), S231 (= S225), S233 (= S227), K234 (= K228), R241 (= R235)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
43% identity, 96% coverage: 6:385/395 of query aligns to 11:402/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R18), G40 (= G35), L41 (= L36)
- binding 2-oxoglutaric acid: D213 (= D197), P214 (= P198), Y215 (= Y199), G216 (= G200), E217 (= E201), G241 (= G224), T242 (≠ S225), I246 (= I229)
- binding (2E)-pent-2-enedioic acid: G40 (= G35), Y130 (= Y120), N184 (= N168), R376 (= R359)
- binding glutamic acid: S20 (= S15), V22 (≠ I17), L131 (= L121), V360 (= V343), A364 (≠ P347), R369 (≠ N352)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G94), S105 (= S95), Q106 (= Q96), Y130 (= Y120), N184 (= N168), D212 (= D196), P214 (= P198), Y215 (= Y199), T242 (≠ S225), S244 (= S227), K245 (= K228), R252 (= R235)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
43% identity, 96% coverage: 6:385/395 of query aligns to 11:402/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S15), V22 (≠ I17), R23 (= R18), L131 (= L121), Q135 (= Q125), A364 (≠ P347), R369 (≠ N352)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R18), G40 (= G35), Y130 (= Y120), L131 (= L121), A132 (≠ G122), N184 (= N168), R376 (= R359)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G94), S105 (= S95), Q106 (= Q96), Y130 (= Y120), V179 (≠ L163), N184 (= N168), D212 (= D196), P214 (= P198), Y215 (= Y199), T242 (≠ S225), S244 (= S227), K245 (= K228), R252 (= R235)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
43% identity, 96% coverage: 6:385/395 of query aligns to 11:402/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R18), Y70 (= Y65), Y130 (= Y120), L275 (= L258)
- binding pyridoxal-5'-phosphate: G104 (= G94), S105 (= S95), Q106 (= Q96), Y130 (= Y120), V179 (≠ L163), N184 (= N168), D212 (= D196), P214 (= P198), Y215 (= Y199), T242 (≠ S225), S244 (= S227), K245 (= K228), R252 (= R235)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
43% identity, 96% coverage: 6:385/395 of query aligns to 11:402/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G94), S105 (= S95), Q106 (= Q96), Y130 (= Y120), V179 (≠ L163), N184 (= N168), D212 (= D196), P214 (= P198), Y215 (= Y199), T242 (≠ S225), S244 (= S227), K245 (= K228), R252 (= R235)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
47% identity, 98% coverage: 1:386/395 of query aligns to 1:387/389 of 2z1yA
- binding leucine: G32 (= G35), Y117 (= Y120), R360 (= R359)
- binding pyridoxal-5'-phosphate: G91 (= G94), S92 (= S95), Q93 (= Q96), Y117 (= Y120), N166 (= N168), D194 (= D196), Y197 (= Y199), S227 (= S225), S229 (= S227), K230 (= K228), R237 (= R235)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
43% identity, 97% coverage: 5:387/395 of query aligns to 7:402/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G94), S103 (= S95), Q104 (= Q96), Y128 (= Y120), V177 (≠ L163), N182 (= N168), D210 (= D196), P212 (= P198), Y213 (= Y199), T240 (≠ S225), S242 (= S227), K243 (= K228), R250 (= R235)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
38% identity, 98% coverage: 5:391/395 of query aligns to 16:416/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G94), S113 (= S95), Q114 (= Q96), Y138 (= Y120), N194 (= N168), D222 (= D196), P224 (= P198), Y225 (= Y199), T252 (≠ S225), S254 (= S227), K255 (= K228), R262 (= R235)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
33% identity, 96% coverage: 5:383/395 of query aligns to 7:403/405 of 2zc0A
- active site: Y132 (= Y120), D214 (= D196), A216 (≠ P198), S246 (= S227)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G94), G107 (≠ S95), T108 (≠ Q96), Y132 (= Y120), N186 (= N168), D214 (= D196), A216 (≠ P198), Y217 (= Y199), T244 (≠ S225), S246 (= S227), K247 (= K228), R254 (= R235)
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 97% coverage: 1:385/395 of query aligns to 1:425/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G35), L40 (= L36), Y74 (= Y65), S117 (= S95), Q118 (= Q96), Y142 (= Y120), N202 (= N168), D230 (= D196), P232 (= P198), Y233 (= Y199), S260 (= S225), S262 (= S227), K263 (= K228), R270 (= R235), R399 (= R359)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 97% coverage: 1:385/395 of query aligns to 1:425/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I17), R20 (= R18), T23 (≠ L21), G39 (= G35), L40 (= L36), Y74 (= Y65), S75 (≠ A66), S77 (≠ T68), S117 (= S95), Q118 (= Q96), Y142 (= Y120), N202 (= N168), D230 (= D196), P232 (= P198), Y233 (= Y199), S260 (= S225), S262 (= S227), R270 (= R235), L293 (= L258), R399 (= R359)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 97% coverage: 1:385/395 of query aligns to 1:425/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I17), G39 (= G35), Y74 (= Y65), S75 (≠ A66), S77 (≠ T68), S117 (= S95), Q118 (= Q96), Y142 (= Y120), N202 (= N168), D230 (= D196), P232 (= P198), Y233 (= Y199), S260 (= S225), S262 (= S227), R270 (= R235), L293 (= L258), R399 (= R359)
4gdyB Kynurenine aminotransferase ii inhibitors
31% identity, 97% coverage: 1:385/395 of query aligns to 1:425/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (= I17), M33 (≠ V29), G39 (= G35), Y74 (= Y65), S75 (≠ A66), G116 (= G94), S117 (= S95), Q118 (= Q96), Y142 (= Y120), N202 (= N168), D230 (= D196), P232 (= P198), S260 (= S225), S262 (= S227), R270 (= R235), R399 (= R359)
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
31% identity, 91% coverage: 27:385/395 of query aligns to 20:414/414 of 2vgzA
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
31% identity, 97% coverage: 1:385/395 of query aligns to 4:428/428 of 6t8qA
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
31% identity, 97% coverage: 1:385/395 of query aligns to 1:425/425 of 5tf5A
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
31% identity, 97% coverage: 1:385/395 of query aligns to 1:425/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: I19 (= I17), R20 (= R18), Y142 (= Y120), R399 (= R359)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (= S95), Q118 (= Q96), Y142 (= Y120), N202 (= N168), D230 (= D196), P232 (= P198), Y233 (= Y199), S260 (= S225), S262 (= S227), K263 (= K228), R270 (= R235)
Query Sequence
>RR42_RS14595 FitnessBrowser__Cup4G11:RR42_RS14595
MNWAISRRAQQLTSSAIREILKVTERPEVISFAGGLPSPATFPVAAMEQAVARIFADNPQ
AALQYAATEGYMPLREFIAKRHAVDVERVLITTGSQQALDLIAKVMIDPGSPVLVETPSY
LGALQAFSLFEPEFVSVPGDDKSLLPESLTPELTAGARFLYALPNFQNPTGRRMPLERRQ
ALVARARELGLLLVEDDPYGELSYSGDQLPSLLSMNPDGVIYMGSFSKILAPGLRLGFVI
APPELHFKLCQAKQASDLHTPSFTQRLAYEVVRDGLLDSHIPTIRTLYAAQCQAMLDSLA
RHMPEGVTWNAPEGGMFIWMELPEGLDSMEILQEAVNRNVAYVPGAPFYASNPRRNALRL
AFVTVAPERIEQGVAILGTLFREAIAKHAPQAKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory