SitesBLAST
Comparing RR42_RS14805 FitnessBrowser__Cup4G11:RR42_RS14805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
45% identity, 90% coverage: 11:291/313 of query aligns to 16:288/308 of P27305
- E55 (= E50) binding
- Y182 (= Y189) binding
- R200 (= R207) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
45% identity, 90% coverage: 11:291/313 of query aligns to 4:274/290 of 4a91A
- active site: S11 (= S18), K229 (= K248)
- binding glutamic acid: R7 (= R14), A9 (= A16), S11 (= S18), E43 (= E50), Y170 (= Y189), R188 (= R207), L192 (= L211)
- binding zinc ion: C99 (= C106), C101 (= C108), Y113 (= Y129), C117 (= C133)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
37% identity, 78% coverage: 12:255/313 of query aligns to 4:247/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
37% identity, 78% coverage: 12:255/313 of query aligns to 4:247/471 of P04805
- C98 (= C106) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C108) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C133) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ D135) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (vs. gap) mutation to Q: No change in activity or in zinc content.
- H131 (= H138) mutation to Q: No change in activity or in zinc content.
- H132 (≠ G139) mutation to Q: No change in activity or in zinc content.
- C138 (≠ W145) mutation to S: No change in activity or in zinc content.
- S239 (= S247) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
38% identity, 78% coverage: 12:255/313 of query aligns to 4:232/380 of 4g6zA
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
36% identity, 83% coverage: 10:270/313 of query aligns to 1:272/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
36% identity, 83% coverage: 10:270/313 of query aligns to 2:273/485 of Q8DLI5
- R6 (= R14) binding
- Y192 (= Y189) binding
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
34% identity, 78% coverage: 12:256/313 of query aligns to 104:343/564 of 3al0C
- active site: S110 (= S18), K335 (= K248)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R14), A108 (= A16), P109 (= P17), G118 (= G26), T122 (= T30), E142 (= E50), Y276 (= Y189), R294 (= R207), G295 (= G208), D297 (= D210), H298 (≠ L211), L324 (≠ V237), I325 (≠ V238), L333 (= L246)
- binding : T144 (≠ I52), D145 (= D53), R148 (= R56), Y208 (≠ A114), P213 (≠ H119), K252 (≠ Q164), M255 (≠ Q167), I266 (≠ V179), K269 (≠ R182), S270 (≠ A183), Y276 (= Y189), D297 (= D210), H298 (≠ L211), L299 (= L212), S300 (≠ D213), N301 (≠ S214), K304 (≠ R217), R330 (≠ G243), P332 (≠ K245)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
29% identity, 92% coverage: 12:300/313 of query aligns to 4:310/502 of 6brlA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
33% identity, 79% coverage: 10:255/313 of query aligns to 1:260/485 of 4griB
- active site: S9 (= S18), K253 (= K248)
- binding glutamic acid: R5 (= R14), A7 (= A16), S9 (= S18), E41 (= E50), Y194 (= Y189), R212 (= R207), W216 (≠ L211)
- binding zinc ion: C105 (= C106), C107 (= C108), Y128 (= Y129), C132 (= C133)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of 2cv2A
- active site: K246 (= K248)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R14), A7 (= A16), S9 (= S18), G17 (= G26), I21 (≠ T30), E41 (= E50), Y187 (= Y189), R205 (= R207), A206 (≠ G208), E208 (≠ D210), W209 (≠ L211), L235 (≠ V237), L236 (≠ V238)
- binding : S9 (= S18), T43 (≠ I52), D44 (= D53), R47 (= R56), V145 (vs. gap), R163 (≠ A154), Y168 (≠ F159), E172 (= E174), V177 (= V179), K180 (≠ R182), S181 (≠ A183), Y187 (= Y189), E207 (≠ A209), E208 (≠ D210), W209 (≠ L211), V211 (≠ D213), R237 (≠ T239), K241 (≠ G243)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of 2cv1A
- active site: K246 (= K248)
- binding adenosine-5'-triphosphate: P8 (= P17), S9 (= S18), G17 (= G26), T18 (≠ S27), I21 (≠ T30), R47 (= R56), A206 (≠ G208), W209 (≠ L211), L235 (≠ V237), L236 (≠ V238)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R14), A7 (= A16), E41 (= E50), Y187 (= Y189), R205 (= R207), W209 (≠ L211)
- binding : S9 (= S18), E41 (= E50), T43 (≠ I52), D44 (= D53), R47 (= R56), V145 (vs. gap), R163 (≠ A154), V166 (≠ I157), E172 (= E174), V177 (= V179), K180 (≠ R182), S181 (≠ A183), Y187 (= Y189), E207 (≠ A209), E208 (≠ D210), W209 (≠ L211), V211 (≠ D213), R237 (≠ T239), K241 (≠ G243), K243 (= K245)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of 1n78A
- active site: K246 (= K248)
- binding glutamol-amp: R5 (= R14), A7 (= A16), P8 (= P17), S9 (= S18), G17 (= G26), T18 (≠ S27), I21 (≠ T30), E41 (= E50), Y187 (= Y189), N191 (≠ V193), R205 (= R207), A206 (≠ G208), E208 (≠ D210), W209 (≠ L211), L235 (≠ V237), L236 (≠ V238)
- binding : S9 (= S18), T43 (≠ I52), D44 (= D53), R47 (= R56), V145 (vs. gap), R163 (≠ A154), V166 (≠ I157), Y168 (≠ F159), E172 (= E174), V177 (= V179), K180 (≠ R182), S181 (≠ A183), Y187 (= Y189), E207 (≠ A209), E208 (≠ D210), W209 (≠ L211), L210 (= L212), V211 (≠ D213), R237 (≠ T239), K241 (≠ G243)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of 1j09A
- active site: K246 (= K248)
- binding adenosine-5'-triphosphate: H15 (= H24), E208 (≠ D210), L235 (≠ V237), L236 (≠ V238), K243 (= K245), I244 (≠ L246), S245 (= S247), K246 (= K248), R247 (≠ Q249)
- binding glutamic acid: R5 (= R14), A7 (= A16), S9 (= S18), E41 (= E50), Y187 (= Y189), N191 (≠ V193), R205 (= R207), W209 (≠ L211)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
32% identity, 78% coverage: 14:256/313 of query aligns to 5:254/468 of 1g59A
- binding : D44 (= D53), R45 (≠ Y54), A46 (≠ P55), R47 (= R56), P109 (≠ R110), V145 (vs. gap), R163 (≠ A154), V166 (≠ I157), E172 (= E174), V177 (= V179), K180 (≠ R182), S181 (≠ A183), D182 (= D184), E207 (≠ A209), E208 (≠ D210), R237 (≠ T239), K241 (≠ G243), T242 (≠ E244), K243 (= K245)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
31% identity, 81% coverage: 10:264/313 of query aligns to 3:270/488 of 8vc5A
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
27% identity, 71% coverage: 14:234/313 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
Query Sequence
>RR42_RS14805 FitnessBrowser__Cup4G11:RR42_RS14805
MPTRPSLAPSYRGRFAPSPTGPLHMGSLVTALASWLDARAHLGSWLVRIEDIDYPRCVRG
ADQQILRALARLGLHPDEPPQWQSRREALYAEALRQLDADHWTYPCGCSRKEIADSLLHA
RERHQTLGYPGTCRDGLHGKPPRAWRVRVPDGDAALICFDDRWQGRQCQDLATELGDFVL
RRADGLWAYQLAVVVDDGHQGITHIVRGADLLDSTPRQIHLQHLLGLPTPSYLHVPVVTN
ALGEKLSKQSGAQAIDDLDPLAALRTAGAHLGLASAAQSVQSWLSDATAGWAALLERLPA
QAHREATTPPRMA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory