Comparing RR42_RS15100 FitnessBrowser__Cup4G11:RR42_RS15100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
81% identity, 98% coverage: 4:288/292 of query aligns to 2:282/282 of 5ve7A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
79% identity, 98% coverage: 4:289/292 of query aligns to 4:289/290 of 5i1fA
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
53% identity, 93% coverage: 7:277/292 of query aligns to 7:275/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
54% identity, 90% coverage: 5:267/292 of query aligns to 8:271/281 of 8f73E
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
52% identity, 90% coverage: 5:267/292 of query aligns to 2:257/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
52% identity, 90% coverage: 5:267/292 of query aligns to 2:257/264 of 3jukD
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
49% identity, 96% coverage: 5:285/292 of query aligns to 2:286/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
49% identity, 96% coverage: 5:285/292 of query aligns to 2:286/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
48% identity, 96% coverage: 5:285/292 of query aligns to 2:281/285 of 6ikzB
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
47% identity, 93% coverage: 7:277/292 of query aligns to 7:242/255 of 2ux8A
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
44% identity, 97% coverage: 6:289/292 of query aligns to 3:288/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
42% identity, 97% coverage: 6:289/292 of query aligns to 3:283/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
42% identity, 93% coverage: 5:275/292 of query aligns to 3:276/299 of 2pa4B
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
30% identity, 82% coverage: 7:245/292 of query aligns to 7:215/296 of 5fyeA
Sites not aligning to the query:
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
30% identity, 82% coverage: 7:245/292 of query aligns to 7:215/296 of 5fu0A
Sites not aligning to the query:
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
30% identity, 82% coverage: 7:245/292 of query aligns to 7:215/296 of 5ftvA
Sites not aligning to the query:
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
30% identity, 82% coverage: 7:245/292 of query aligns to 7:215/296 of 5ftsA
Sites not aligning to the query:
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
30% identity, 82% coverage: 7:245/292 of query aligns to 8:216/297 of 3zllA
Sites not aligning to the query:
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
30% identity, 82% coverage: 7:245/292 of query aligns to 8:216/297 of 3zlkA
Sites not aligning to the query:
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
30% identity, 82% coverage: 7:245/292 of query aligns to 3:211/292 of 4asjA
Sites not aligning to the query:
>RR42_RS15100 FitnessBrowser__Cup4G11:RR42_RS15100
METRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGR
SKRAIEDHFDKAYELEAELEAKNKQALLSLVRSIKPSHVECFYVRQPEALGLGHAVLCAE
KLVGDAPFAVMLADDLLDGNPPVMKQMVDLYGHYNCSVLGVEEIAPEQSRSYGVVDGREW
DEGVIKVSNIVEKPAPENAPSNLGVVGRYILTPRIFDHIRNLKPGAGGEFQLTDAIQSLL
SQEQVLAYRYKGVRYDCGSKLGYLKATVEFALKHPEVMDEFSTYLRARIDSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory