Comparing RR42_RS15115 FitnessBrowser__Cup4G11:RR42_RS15115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
66% identity, 98% coverage: 2:338/343 of query aligns to 4:339/344 of 5vyeB
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
65% identity, 100% coverage: 2:343/343 of query aligns to 6:346/346 of O50584
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
45% identity, 98% coverage: 4:340/343 of query aligns to 7:344/345 of 1v72A
1jg8D Crystal structure of threonine aldolase (low-specificity)
30% identity, 60% coverage: 29:234/343 of query aligns to 28:226/344 of 1jg8D
Sites not aligning to the query:
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
30% identity, 60% coverage: 29:234/343 of query aligns to 27:225/343 of 1lw5B
Sites not aligning to the query:
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
30% identity, 60% coverage: 29:234/343 of query aligns to 27:225/343 of 1lw4B
Sites not aligning to the query:
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
29% identity, 72% coverage: 29:275/343 of query aligns to 27:270/331 of 3wlxA
Sites not aligning to the query:
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
28% identity, 72% coverage: 29:275/343 of query aligns to 27:270/332 of 4rjyA
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
28% identity, 72% coverage: 29:275/343 of query aligns to 27:270/331 of 4lnmA
Sites not aligning to the query:
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
28% identity, 72% coverage: 29:275/343 of query aligns to 27:270/332 of 4lnlA
Sites not aligning to the query:
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
28% identity, 72% coverage: 29:275/343 of query aligns to 27:270/332 of 4lnjA
Sites not aligning to the query:
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
25% identity, 88% coverage: 29:331/343 of query aligns to 29:326/338 of O07051
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 69% coverage: 56:293/343 of query aligns to 57:295/358 of Q8RXU4
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
25% identity, 90% coverage: 29:335/343 of query aligns to 27:319/324 of 3wgbD
Sites not aligning to the query:
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
25% identity, 88% coverage: 29:331/343 of query aligns to 28:323/333 of 3wgcB
Sites not aligning to the query:
>RR42_RS15115 FitnessBrowser__Cup4G11:RR42_RS15115
MQHFASDNYAGFCPESLKYFLEANGSGHEQAYGDDSWTQKVCDRIRDLFQTDCEVFFVFN
GTAANSLALSALCQSYHSVICHELAHIETDECGGPEFFSNGSKLLTAPGANGKLTPDAVE
ALVTRRSDIHYPKPKVVSLTQSTEVGTVYTVEEVRAIAAIAKRRQLRVHMDGARFANAVA
SLGVHPSEITWRAGVDVLCFGGTKNGLPVGEAVVFFDRKLAEDFAYRVKQAGQLASKMRF
ISAPWLGLLENDVWLGNARHANAMAQLLHERIASIPGVRIMFPTESNAVFAELPLAAIEA
LRAKGWRFYTFIGAGGCRFMCSWDLQPETVEALAADMRVACGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory