SitesBLAST
Comparing RR42_RS15400 FitnessBrowser__Cup4G11:RR42_RS15400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gqtC Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4- tetrahydroquinoxalin-6-yl)methylamine (see paper)
85% identity, 99% coverage: 5:396/397 of query aligns to 1:385/385 of 3gqtC
- active site: L135 (= L139), T136 (= T140), A250 (= A255), E365 (= E376), R377 (= R388)
- binding 1-(1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methanamine: W166 (= W170), K210 (= K215), L213 (= L218), T218 (= T223), Y364 (= Y375)
3eonC 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule (see paper)
84% identity, 98% coverage: 5:395/397 of query aligns to 1:382/382 of 3eonC
3gncA Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 (see paper)
84% identity, 98% coverage: 5:395/397 of query aligns to 2:380/380 of 3gncA
3d6bC 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei (see paper)
83% identity, 98% coverage: 5:395/397 of query aligns to 1:377/377 of 3d6bC
2r0nA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
68% identity, 98% coverage: 6:396/397 of query aligns to 1:388/390 of 2r0nA
- active site: L133 (= L139), T134 (= T140), A247 (= A255), E368 (= E376), R380 (= R388)
- binding flavin-adenine dinucleotide: F131 (= F137), L133 (= L139), T134 (= T140), G139 (= G145), S140 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), Y367 (= Y375), T370 (= T378), D372 (= D380)
- binding 3-thiaglutaryl-CoA: R92 (= R98), S93 (= S99), V97 (= V103), P142 (= P148), G238 (≠ K246), F241 (= F249), L244 (= L252), N245 (= N253), P318 (≠ V326), Y367 (= Y375), E368 (= E376), I377 (= I385)
1sirA The crystal structure and mechanism of human glutaryl-coa dehydrogenase (see paper)
68% identity, 98% coverage: 6:396/397 of query aligns to 1:388/390 of 1sirA
- active site: L133 (= L139), T134 (= T140), A247 (= A255), E368 (= E376), R380 (= R388)
- binding flavin-adenine dinucleotide: F131 (= F137), L133 (= L139), T134 (= T140), G139 (= G145), S140 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), Y367 (= Y375), T370 (= T378)
- binding s-4-nitrobutyryl-coa: S93 (= S99), S140 (= S146), F241 (= F249), G242 (≠ T250), L244 (= L252), N245 (= N253), R248 (= R256), P318 (≠ V326), Y367 (= Y375), E368 (= E376), R380 (= R388)
2r0mA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
68% identity, 98% coverage: 6:396/397 of query aligns to 1:388/390 of 2r0mA
- active site: L133 (= L139), T134 (= T140), A247 (= A255), D368 (≠ E376), R380 (= R388)
- binding 4-nitrobutanoic acid: L101 (= L107), Y367 (= Y375), D368 (≠ E376)
- binding flavin-adenine dinucleotide: F131 (= F137), L133 (= L139), T134 (= T140), G139 (= G145), S140 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), L210 (= L218), Y367 (= Y375), T370 (= T378)
2ebaA Crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus
48% identity, 96% coverage: 15:396/397 of query aligns to 7:380/380 of 2ebaA
- active site: L131 (= L139), T132 (= T140), A239 (= A255), E360 (= E376), R372 (= R388)
- binding flavin-adenine dinucleotide: L131 (= L139), T132 (= T140), G136 (≠ H144), G137 (= G145), S138 (= S146), W161 (= W170), T163 (= T172), R265 (= R281), L272 (= L288), K275 (≠ N291), D333 (= D349), I334 (≠ M350), G337 (= G353), T355 (≠ V371), T358 (= T374), Y359 (= Y375), T362 (= T378)
3sf6A Crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
47% identity, 97% coverage: 10:396/397 of query aligns to 4:386/387 of 3sf6A
- active site: L134 (= L139), T135 (= T140), A245 (= A255), E366 (= E376), Q378 (≠ R388)
- binding dihydroflavine-adenine dinucleotide: F132 (= F137), L134 (= L139), T135 (= T140), G140 (= G145), S141 (= S146), W165 (= W170), I166 (= I171), T167 (= T172), S361 (≠ V371), T364 (= T374), Y365 (= Y375), T368 (= T378), E370 (≠ D380), M371 (≠ I381)
3swoA Crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2 (see paper)
44% identity, 96% coverage: 16:396/397 of query aligns to 13:387/388 of 3swoA
- active site: L135 (= L139), T136 (= T140), A246 (= A255), E367 (= E376), K379 (≠ R388)
- binding dihydroflavine-adenine dinucleotide: F133 (= F137), L135 (= L139), T136 (= T140), G141 (= G145), S142 (= S146), W166 (= W170), I167 (= I171), T168 (= T172), R272 (= R281), V274 (≠ Q283), F275 (= F284), L279 (= L288), Y282 (≠ N291), T340 (≠ D349), L341 (≠ M350), G344 (= G353), I347 (= I356), T365 (= T374), Y366 (= Y375), T369 (= T378), E371 (≠ D380), M372 (≠ I381)
2ix5A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 in complex with acetoacetyl-coa (see paper)
36% identity, 97% coverage: 10:396/397 of query aligns to 30:412/415 of 2ix5A
- active site: L158 (= L139), T159 (= T140), S271 (≠ A255), E392 (= E376), R404 (= R388)
- binding acetoacetyl-coenzyme a: S165 (= S146), A167 (≠ P148), S168 (≠ G149), F261 (≠ L245), L268 (= L252), R272 (= R256), E392 (= E376), G393 (= G377), R404 (= R388)
- binding flavin-adenine dinucleotide: L158 (= L139), T159 (= T140), G164 (= G145), S165 (= S146), W189 (= W170), N239 (≠ T223), R297 (= R281), F300 (= F284), L304 (= L288), F307 (≠ N291), L309 (= L293), N310 (≠ V294), E365 (≠ D349), L366 (≠ M350), G368 (= G352), G369 (= G353), Y391 (= Y375), T394 (= T378), D396 (= D380), I397 (= I381)
Q96329 Acyl-coenzyme A oxidase 4, peroxisomal; AOX 4; G6p; Short-chain acyl-CoA oxidase; AtCX4; AtG6; SAOX; EC 1.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 97% coverage: 10:396/397 of query aligns to 46:428/436 of Q96329
2ix6A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 (see paper)
36% identity, 97% coverage: 10:396/397 of query aligns to 30:412/416 of 2ix6A
- active site: L158 (= L139), T159 (= T140), S271 (≠ A255), E392 (= E376), R404 (= R388)
- binding flavin-adenine dinucleotide: T159 (= T140), G164 (= G145), S165 (= S146), W189 (= W170), N239 (≠ T223), R297 (= R281), F300 (= F284), L304 (= L288), F307 (≠ N291), N310 (≠ V294), E365 (≠ D349), L366 (≠ M350), G369 (= G353), I372 (= I356), Y391 (= Y375), T394 (= T378), D396 (= D380)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
35% identity, 94% coverage: 15:389/397 of query aligns to 1:376/380 of 4l1fA
- active site: L125 (= L139), T126 (= T140), G242 (≠ A255), E363 (= E376), R375 (= R388)
- binding coenzyme a persulfide: T132 (≠ S146), H179 (≠ E193), F232 (≠ L245), M236 (≠ F249), E237 (≠ T250), L239 (= L252), D240 (≠ N253), R243 (= R256), Y362 (= Y375), E363 (= E376), G364 (= G377), R375 (= R388)
- binding flavin-adenine dinucleotide: F123 (= F137), L125 (= L139), T126 (= T140), G131 (= G145), T132 (≠ S146), F156 (≠ W170), I157 (= I171), T158 (= T172), R268 (= R281), Q270 (= Q283), F271 (= F284), I275 (≠ L288), F278 (≠ N291), L281 (≠ V294), Q336 (≠ D349), I337 (≠ M350), G340 (= G353), I358 (≠ V371), Y362 (= Y375), T365 (= T378), Q367 (≠ D380)
- binding 1,3-propandiol: L5 (= L19), Q10 (≠ R24)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
35% identity, 92% coverage: 24:388/397 of query aligns to 11:370/374 of 5lnxD
- active site: L122 (= L139), T123 (= T140), G239 (≠ A255), E358 (= E376), K370 (≠ R388)
- binding flavin-adenine dinucleotide: L122 (= L139), T123 (= T140), G128 (= G145), S129 (= S146), F153 (≠ W170), T155 (= T172), R265 (= R281), Q267 (= Q283), F268 (= F284), I272 (≠ L288), N275 (= N291), I278 (≠ V294), Q331 (≠ D349), I332 (≠ M350), G335 (= G353), Y357 (= Y375), T360 (= T378), E362 (≠ D380)
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
36% identity, 93% coverage: 19:388/397 of query aligns to 1:366/370 of 2dvlA
- active site: L121 (= L139), T122 (= T140), G233 (≠ A255), E354 (= E376), R366 (= R388)
- binding flavin-adenine dinucleotide: L121 (= L139), T122 (= T140), G127 (= G145), S128 (= S146), W152 (= W170), I153 (= I171), T154 (= T172), T356 (= T378), E358 (≠ D380)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
34% identity, 94% coverage: 15:388/397 of query aligns to 2:376/378 of 4n5fA
- active site: L126 (= L139), T127 (= T140), G243 (≠ A255), E364 (= E376), R376 (= R388)
- binding dihydroflavine-adenine dinucleotide: L126 (= L139), T127 (= T140), G132 (= G145), S133 (= S146), F157 (≠ W170), T159 (= T172), T210 (= T223), Y363 (= Y375), T366 (= T378), E368 (≠ D380), M372 (≠ L384)
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
35% identity, 90% coverage: 33:389/397 of query aligns to 19:380/383 of 1bucA
- active site: L128 (= L139), T129 (= T140), G246 (≠ A255), E367 (= E376), G379 (≠ R388)
- binding acetoacetyl-coenzyme a: L96 (= L107), F126 (= F137), G134 (= G145), T135 (≠ S146), T162 (= T172), N182 (≠ K192), H183 (≠ E193), F236 (≠ L245), M240 (≠ F249), M241 (≠ T250), L243 (= L252), D244 (≠ N253), T317 (≠ V326), Y366 (= Y375), E367 (= E376), G368 (= G377)
- binding flavin-adenine dinucleotide: F126 (= F137), L128 (= L139), T129 (= T140), G134 (= G145), T135 (≠ S146), F160 (≠ W170), T162 (= T172), Y366 (= Y375), T369 (= T378), E371 (≠ D380), M375 (≠ L384)
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
35% identity, 90% coverage: 33:389/397 of query aligns to 19:380/383 of Q06319
- E367 (= E376) active site, Proton acceptor; mutation to Q: Loss of activity.
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
31% identity, 93% coverage: 17:386/397 of query aligns to 2:372/378 of 5ol2F
- active site: L124 (= L139), T125 (= T140), G241 (≠ A255)
- binding calcium ion: E29 (≠ Q44), E33 (≠ N48), R35 (≠ K50)
- binding coenzyme a persulfide: L238 (= L252), R242 (= R256), E362 (= E376), G363 (= G377)
- binding flavin-adenine dinucleotide: F122 (= F137), L124 (= L139), T125 (= T140), P127 (= P142), T131 (≠ S146), F155 (≠ W170), I156 (= I171), T157 (= T172), E198 (≠ H213), R267 (= R281), F270 (= F284), L274 (= L288), F277 (≠ N291), Q335 (≠ D349), L336 (≠ M350), G338 (= G352), G339 (= G353), Y361 (= Y375), T364 (= T378), E366 (≠ D380)
Sites not aligning to the query:
Query Sequence
>RR42_RS15400 FitnessBrowser__Cup4G11:RR42_RS15400
MAANAEFHWADPLLLDDQLSADERMVRDAALAYCQDKLAPRVLQSFRNEKTDIEIFREMG
ELGLLGPTIPEEYGGPGLNYVAYGLIAREVERVDSGYRSMMSVQSSLVMVPIHEFGSEAQ
KQKYLPKLATGEWIGCFGLTEPNHGSDPGSMITRAKKVAGGYELSGAKMWITNSPIADVF
VVWGKLVGDDGKEAIRGFILEKGWKGLSAPAIHGKVGLRTSITGEIVMDQVFVPEENLMP
GVSGLKGPFTCLNSARYGIAWGALGAAEFCWHTARQYTLDRKQFGRPLAANQLVQKKLAD
MQTEITLGLQGCLRLGRMKDEGTAAVEITSIMKRNSCGKSLDIARVARDMLGGNGISDEF
GVIRHVVNLEVVNTYEGTHDIHALILGRAQTGIQAFF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory