SitesBLAST
Comparing RR42_RS15840 FitnessBrowser__Cup4G11:RR42_RS15840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
61% identity, 99% coverage: 4:354/354 of query aligns to 3:359/361 of 1kewA
- active site: T133 (= T135), D134 (= D136), E135 (= E137), L152 (vs. gap), L154 (≠ A148), F155 (= F149), T158 (= T152), Y167 (= Y161), K171 (= K165)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D34), K33 (= K35), L34 (= L36), T35 (= T37), A37 (= A39), G38 (= G40), D58 (= D60), I59 (= I61), L80 (≠ F82), A81 (= A83), A82 (= A84), S84 (= S86), T99 (= T101), I131 (≠ V133), S132 (= S134), T133 (= T135), Y167 (= Y161), K171 (= K165), C194 (= C188), N196 (= N190), N197 (= N191)
- binding thymidine-5'-diphosphate: E135 (= E137), N196 (= N190), K206 (= K200), L207 (= L201), P222 (= P216), Y224 (= Y218), R231 (= R225), N266 (= N260), R297 (= R292), H300 (= H295), Y357 (≠ H352)
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
61% identity, 99% coverage: 4:354/354 of query aligns to 3:359/361 of 1keuA
- active site: T133 (= T135), D134 (= D136), E135 (= E137), L152 (vs. gap), L154 (≠ A148), F155 (= F149), T158 (= T152), Y167 (= Y161), K171 (= K165)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S86), T133 (= T135), D134 (= D136), E135 (= E137), Y167 (= Y161), N196 (= N190), K206 (= K200), L207 (= L201), P222 (= P216), Y224 (= Y218), R231 (= R225), N266 (= N260), R297 (= R292), H300 (= H295), Y357 (≠ H352)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D34), K33 (= K35), L34 (= L36), T35 (= T37), G38 (= G40), D58 (= D60), L80 (≠ F82), A81 (= A83), A82 (= A84), S84 (= S86), T99 (= T101), S132 (= S134), T133 (= T135), Y167 (= Y161), K171 (= K165), C194 (= C188), N196 (= N190), N197 (= N191)
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
61% identity, 99% coverage: 4:354/354 of query aligns to 3:359/361 of P26391
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
62% identity, 98% coverage: 1:348/354 of query aligns to 1:350/355 of P27830
- FI 12:13 (= FI 12:13) binding
- DKLT 33:36 (= DKLT 34:37) binding
- DI 59:60 (= DI 60:61) binding
- T100 (= T101) binding
- D135 (= D136) active site, Proton donor
- E136 (= E137) active site, Proton acceptor
- Y160 (= Y161) active site, Proton acceptor
- YSASK 160:164 (= YSASK 161:165) binding
- N190 (= N191) binding
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
60% identity, 98% coverage: 1:348/354 of query aligns to 1:344/344 of 1bxkB
- active site: S125 (≠ D126), T134 (= T135), D135 (= D136), E136 (= E137), S158 (= S159), Y160 (= Y161), S161 (= S162), K164 (= K165)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D33 (= D34), K34 (= K35), L35 (= L36), T36 (= T37), A38 (= A39), G39 (= G40), D59 (= D60), I60 (= I61), L81 (≠ F82), A83 (= A84), T100 (= T101), I132 (≠ V133), S133 (= S134), T134 (= T135), K164 (= K165), C187 (= C188)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
51% identity, 98% coverage: 1:346/354 of query aligns to 3:354/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D34), A37 (≠ K35), L38 (= L36), T39 (= T37), G42 (= G40), D62 (= D60), I63 (= I61), L84 (≠ F82), A85 (= A83), A86 (= A84), T103 (= T101), S143 (= S134), T144 (= T135), Y169 (= Y161), K173 (= K165), C196 (= C188)
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
49% identity, 94% coverage: 3:335/354 of query aligns to 3:306/311 of 6bi4C
- active site: T117 (= T135), D118 (= D136), E119 (= E137), Y142 (= Y161), K146 (= K165)
- binding beta-D-fructofuranose: Q62 (≠ C62), N63 (≠ D63), G64 (≠ R64), E65 (≠ A65)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D34 (= D34), A35 (≠ K35), L36 (= L36), T37 (= T37), S39 (≠ A39), G40 (= G40), E60 (≠ D60), I61 (= I61), Q62 (≠ C62), F82 (= F82), A83 (= A83), A84 (= A84), T92 (= T101), V115 (= V133), T117 (= T135), Y142 (= Y161), K146 (= K165), C169 (= C188), S170 (= S189)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
48% identity, 94% coverage: 3:335/354 of query aligns to 3:305/310 of 6bi4B
- active site: T117 (= T135), D118 (= D136), E119 (= E137), Y142 (= Y161), K146 (= K165)
- binding alpha-D-glucopyranose: Q62 (≠ C62), N63 (≠ D63)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D34 (= D34), A35 (≠ K35), L36 (= L36), T37 (= T37), S39 (≠ A39), G40 (= G40), E60 (≠ D60), F82 (= F82), A83 (= A83), A84 (= A84), T92 (= T101), S116 (= S134), T117 (= T135), Y142 (= Y161), K146 (= K165), C169 (= C188)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
45% identity, 94% coverage: 4:335/354 of query aligns to 4:312/329 of 2hunA
- active site: T125 (= T135), D126 (= D136), E127 (= E137), Y149 (= Y161), K153 (= K165)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D34 (= D34), K35 (= K35), S40 (≠ G40), D60 (= D60), V61 (≠ I61), L80 (≠ F82), A81 (= A83), A82 (= A84), S99 (≠ T101), T125 (= T135), K153 (= K165), C176 (= C188), T177 (≠ S189), N178 (= N190), N179 (= N191)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
47% identity, 94% coverage: 4:335/354 of query aligns to 3:317/322 of 1r66A
- active site: T127 (= T135), D128 (= D136), E129 (= E137), Y151 (= Y161), K155 (= K165)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D37 (= D34), S38 (≠ K35), L39 (= L36), T40 (= T37), G43 (= G40), D63 (= D60), I64 (= I61), F83 (= F82), A84 (= A83), A85 (= A84), S87 (= S86), T102 (= T101), V125 (= V133), S126 (= S134), Y151 (= Y161), K155 (= K165), N181 (= N191)
- binding thymidine-5'-diphosphate: H88 (= H87), E129 (= E137), N180 (= N190), K190 (= K200), L191 (= L201), P206 (= P216), Y208 (= Y218), R215 (= R225), N250 (= N260), R274 (= R292), H277 (= H295)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
47% identity, 94% coverage: 4:335/354 of query aligns to 3:317/322 of 1r6dA
- active site: T127 (= T135), N128 (≠ D136), Q129 (≠ E137), Y151 (= Y161), K155 (= K165)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S86), H88 (= H87), T127 (= T135), N128 (≠ D136), Q129 (≠ E137), Y151 (= Y161), N180 (= N190), K190 (= K200), L191 (= L201), P206 (= P216), Y208 (= Y218), R215 (= R225), N250 (= N260), R274 (= R292), H277 (= H295), Y281 (= Y299)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D37 (= D34), S38 (≠ K35), L39 (= L36), T40 (= T37), A42 (= A39), G43 (= G40), D63 (= D60), I64 (= I61), F83 (= F82), A84 (= A83), A85 (= A84), S87 (= S86), T102 (= T101), V125 (= V133), S126 (= S134), Y151 (= Y161), K155 (= K165), N181 (= N191)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
44% identity, 95% coverage: 1:335/354 of query aligns to 3:327/347 of 1kerB
- active site: T124 (= T135), D125 (= D136), E126 (= E137), Y160 (= Y161), K164 (= K165)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S86), N87 (≠ V88), T124 (= T135), D125 (= D136), E126 (= E137), Y160 (= Y161), N189 (= N190), K199 (= K200), F200 (≠ L201), R203 (≠ L204), Q204 (≠ V205), K215 (≠ P216), L216 (≠ V217), Y217 (= Y218), R224 (= R225), N259 (= N260), R283 (= R292), H286 (= H295)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D34), K37 (= K35), L38 (= L36), T39 (= T37), G42 (= G40), D61 (= D60), I62 (= I61), Y81 (≠ F82), A82 (= A83), A83 (= A84), S85 (= S86), T100 (= T101), S123 (= S134), T124 (= T135), Y160 (= Y161), K164 (= K165), C187 (= C188), N190 (= N191)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
44% identity, 95% coverage: 1:335/354 of query aligns to 2:326/346 of 1ketA
- active site: T123 (= T135), D124 (= D136), E125 (= E137), Y159 (= Y161), K163 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), F13 (= F12), I14 (= I13), D35 (= D34), K36 (= K35), L37 (= L36), T38 (= T37), A40 (= A39), G41 (= G40), D60 (= D60), I61 (= I61), Y80 (≠ F82), A82 (= A84), S84 (= S86), T99 (= T101), S122 (= S134), T123 (= T135), Y159 (= Y161), K163 (= K165)
- binding thymidine-5'-diphosphate: E125 (= E137), N188 (= N190), F199 (≠ L201), R202 (≠ L204), Q203 (≠ V205), K214 (≠ P216), Y216 (= Y218), R223 (= R225), N258 (= N260), R282 (= R292), H285 (= H295)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
44% identity, 95% coverage: 1:335/354 of query aligns to 2:326/346 of 1kepA
- active site: T123 (= T135), D124 (= D136), E125 (= E137), Y159 (= Y161), K163 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), F13 (= F12), I14 (= I13), D35 (= D34), K36 (= K35), L37 (= L36), T38 (= T37), G41 (= G40), D60 (= D60), I61 (= I61), Y80 (≠ F82), A81 (= A83), A82 (= A84), S84 (= S86), T99 (= T101), S122 (= S134), Y159 (= Y161), K163 (= K165), N189 (= N191)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S86), T123 (= T135), E125 (= E137), Y159 (= Y161), N188 (= N190), K198 (= K200), R223 (= R225), R282 (= R292)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
44% identity, 94% coverage: 2:335/354 of query aligns to 5:328/348 of P95780
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
43% identity, 95% coverage: 1:335/354 of query aligns to 6:320/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G11), F17 (= F12), I18 (= I13), D43 (= D34), S44 (≠ K35), L45 (= L36), T46 (= T37), G49 (= G40), D67 (= D60), F87 (= F82), A88 (= A83), A89 (= A84), T91 (≠ S86), T106 (= T101), V129 (= V133), S130 (= S134), T131 (= T135), Y155 (= Y161), K159 (= K165)
- binding thymidine-5'-diphosphate: E133 (= E137), N184 (= N190), K194 (= K200), V195 (≠ L201), P210 (= P216), Y212 (= Y218), R219 (= R225), N254 (= N260), R278 (= R292), H281 (= H295)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
43% identity, 95% coverage: 1:335/354 of query aligns to 7:321/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), F18 (= F12), I19 (= I13), D44 (= D34), S45 (≠ K35), L46 (= L36), T47 (= T37), G50 (= G40), D68 (= D60), I69 (= I61), F88 (= F82), A89 (= A83), A90 (= A84), T92 (≠ S86), T107 (= T101), V130 (= V133), Y156 (= Y161), K160 (= K165), G184 (≠ S189), N186 (= N191)
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
40% identity, 96% coverage: 3:343/354 of query aligns to 8:333/669 of Q9SYM5
- R283 (= R292) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
39% identity, 96% coverage: 3:343/354 of query aligns to 10:335/667 of Q9LPG6
- G18 (= G11) mutation to A: Abolishes dehydratase activity.
- K36 (≠ A29) mutation to A: Reduces dehydratase activity.
- D96 (= D89) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K165) mutation to A: Abolishes dehydratase activity.
- G193 (= G193) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
34% identity, 94% coverage: 1:333/354 of query aligns to 3:316/319 of 6vloA
- active site: T126 (= T135), D127 (= D136), E128 (= E137), Y151 (= Y161), K155 (= K165)
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D34), I37 (≠ K35), A42 (≠ G40), D59 (= D60), I60 (= I61), F81 (= F82), A82 (= A83), A83 (= A84), S85 (= S86), M124 (≠ V133), T126 (= T135), K155 (= K165)
- binding thymidine-5'-diphosphate: N180 (= N190), K190 (= K200), L191 (= L201), K194 (≠ L204), H206 (≠ P216), Q208 (≠ Y218), R215 (= R225), V250 (≠ N260), R275 (= R292), R281 (= R298)
Query Sequence
>RR42_RS15840 FitnessBrowser__Cup4G11:RR42_RS15840
MSHILVTGGAGFIGANFVLDWLREDGADAVVNVDKLTYAGNLESLASLKCSNRHIFSQTD
ICDRAALDRLFAEYRPRAVVHFAAESHVDRSIEGPGGFIQTNVVGTFTLLEAARAYWSGL
HGSERDVFRFLHVSTDEVFGSLQPSDPAFTETTAFAPNSPYSASKAAADHLVRAYYHTYG
LPVLTTNCSNNYGPYHFPEKLIPLVLMKALAGEPLPVYGDGLNVRDWLYVGDHCAAVRAV
LAKGRVGETYNVGGNNTKTNLDVVHTLCGLLDELRPKVTGSYRQQITFVADRPGHDRRYA
VDSRKLQVELGWTCKETFETGLRKTVQWHLENQSWVSNVMSGLYRKGRDECHAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory