SitesBLAST
Comparing RR42_RS15975 FitnessBrowser__Cup4G11:RR42_RS15975 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
34% identity, 74% coverage: 6:169/221 of query aligns to 7:158/205 of P18776
- C102 (= C91) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
35% identity, 76% coverage: 1:167/221 of query aligns to 1:146/193 of 2vpyF
- binding pentachlorophenol: I91 (= I89), C93 (= C91)
- binding iron/sulfur cluster: C13 (= C13), G15 (≠ E15), C16 (= C16), C19 (= C19), C23 (= C23), N27 (≠ H27), L36 (≠ V39), I38 (≠ V41), P55 (vs. gap), Q57 (≠ A55), C58 (= C56), L59 (≠ M57), C61 (= C59), P65 (= P63), C66 (= C64), C70 (= C68), P71 (= P69), V83 (= V81), C90 (= C88), I91 (= I89), A92 (≠ G90), C93 (= C91), G94 (= G92), C96 (= C94), C100 (= C98), P101 (= P99), Y102 (≠ F100), R105 (≠ P103), V113 (≠ M117), C116 (= C120), F118 (= F122), C119 (= C123), P129 (= P150), A130 (≠ L151), C131 (= C152), C135 (= C156), C139 (≠ A160), R140 (≠ L161)
Sites not aligning to the query:
2vpwF Polysulfide reductase with bound menaquinone (see paper)
35% identity, 76% coverage: 1:167/221 of query aligns to 1:146/193 of 2vpwF
- binding iron/sulfur cluster: C13 (= C13), G15 (≠ E15), C16 (= C16), C19 (= C19), C23 (= C23), N27 (≠ H27), L36 (≠ V39), I38 (≠ V41), P55 (vs. gap), Q57 (≠ A55), C58 (= C56), L59 (≠ M57), H60 (= H58), C61 (= C59), P65 (= P63), C66 (= C64), C70 (= C68), P71 (= P69), V83 (= V81), C90 (= C88), I91 (= I89), A92 (≠ G90), C93 (= C91), G94 (= G92), C96 (= C94), C100 (= C98), P101 (= P99), Y102 (≠ F100), R105 (≠ P103), V113 (≠ M117), C116 (= C120), F118 (= F122), C119 (= C123), P129 (= P150), A130 (≠ L151), C131 (= C152), C135 (= C156), C139 (≠ A160), R140 (≠ L161)
Sites not aligning to the query:
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
28% identity, 75% coverage: 3:167/221 of query aligns to 2:194/234 of 6cz7B
- binding iron/sulfur cluster: C12 (= C13), V13 (≠ I14), G14 (≠ E15), C15 (= C16), G16 (≠ N17), C18 (= C19), C22 (= C23), N26 (≠ H27), Y52 (vs. gap), P54 (≠ S53), C57 (= C56), N58 (≠ M57), H59 (= H58), C60 (= C59), A63 (= A62), P64 (= P63), C65 (= C64), C69 (= C68), P70 (= P69), T82 (≠ V81), C89 (= C88), I90 (= I89), G91 (= G90), C92 (= C91), K93 (≠ G92), C95 (= C94), C99 (= C98), Y101 (≠ F100), V103 (≠ A102), I104 (≠ P103), T161 (vs. gap), K163 (vs. gap), C164 (vs. gap), F166 (vs. gap), C167 (vs. gap), C179 (= C152), C183 (= C156), P184 (≠ S157), R188 (≠ L161)
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
28% identity, 75% coverage: 3:167/221 of query aligns to 2:194/234 of Q7WTT9
- C12 (= C13) binding
- C15 (= C16) binding
- C18 (= C19) binding
- C22 (= C23) binding
- C57 (= C56) binding
- C60 (= C59) binding
- C65 (= C64) binding
- C69 (= C68) binding
- C89 (= C88) binding
- C92 (= C91) binding
- C95 (= C94) binding
- C99 (= C98) binding
- C164 (vs. gap) binding
- C167 (vs. gap) binding
- C179 (= C152) binding
- C183 (= C156) binding
6f0kB Alternative complex iii (see paper)
29% identity, 72% coverage: 7:165/221 of query aligns to 727:915/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C68), V805 (= V70), M818 (≠ H83), C823 (= C88), I824 (= I89), G825 (= G90), C829 (= C94), M869 (= M117)
- binding heme c: N821 (≠ D86), R822 (≠ I87), R884 (≠ S132), N887 (≠ E135)
- binding iron/sulfur cluster: C733 (= C13), T734 (≠ I14), G735 (≠ E15), C736 (= C16), N737 (= N17), A738 (≠ S18), C739 (= C19), C743 (= C23), W765 (vs. gap), I768 (vs. gap), C791 (= C56), M792 (= M57), H793 (= H58), C794 (= C59), P798 (= P63), C799 (= C64), N816 (≠ V81), C833 (= C98), C872 (= C120), Y874 (≠ F122), C875 (= C123), A901 (vs. gap), C902 (= C152), C906 (= C156)
Sites not aligning to the query:
7qv7A Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
31% identity, 85% coverage: 7:194/221 of query aligns to 6:174/174 of 7qv7A
- binding iron/sulfur cluster: C12 (= C13), L13 (≠ I14), G14 (≠ E15), C15 (= C16), Y16 (≠ N17), C18 (= C19), C22 (= C23), H26 (= H27), L37 (≠ R36), C51 (= C56), R52 (≠ M57), C54 (= C59), C59 (= C64), C63 (= C68), C82 (= C88), I83 (= I89), G84 (= G90), C85 (= C91), C88 (= C94), C92 (= C98), I97 (≠ P103), F99 (= F111), C125 (vs. gap), L127 (vs. gap), C128 (vs. gap), A136 (≠ L151), C137 (= C152), C141 (= C156)
6lodB Cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii (see paper)
26% identity, 71% coverage: 9:165/221 of query aligns to 688:884/929 of 6lodB
- binding fe3-s4 cluster: V758 (= V67), C759 (= C68), P760 (= P69), C779 (= C88), V780 (≠ I89), G781 (= G90), T782 (≠ C91), C785 (= C94), M838 (= M117)
- binding heme c: N777 (≠ D86), R778 (≠ I87), R852 (≠ E135), I853 (≠ F136), R856 (≠ Y139)
- binding iron/sulfur cluster: C692 (= C13), N693 (≠ I14), S694 (≠ E15), C695 (= C16), N696 (= N17), A697 (≠ S18), C698 (= C19), C702 (= C23), N706 (≠ H27), W724 (≠ V38), I727 (≠ V41), L746 (≠ A55), C747 (= C56), Q748 (≠ M57), Q749 (≠ H58), C750 (= C59), P754 (= P63), C755 (= C64), N772 (≠ V81), C789 (= C98), Y791 (≠ F100), V793 (≠ A102), R794 (≠ P103), K840 (= K119), C841 (= C120), F843 (= F122), C844 (= C123), T869 (≠ P150), C871 (= C152), C875 (= C156), I880 (≠ L161)
7z0sB Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
28% identity, 73% coverage: 6:166/221 of query aligns to 5:169/170 of 7z0sB
- binding iron/sulfur cluster: C12 (= C13), I13 (= I14), G14 (≠ E15), C15 (= C16), H16 (≠ N17), T17 (≠ S18), C18 (= C19), C22 (= C23), H26 (= H27), R36 (= R35), L37 (≠ R36), P48 (≠ S53), L50 (≠ A55), C51 (= C56), H52 (≠ M57), H53 (= H58), C54 (= C59), C59 (= C64), C63 (= C68), P64 (= P69), I68 (≠ F73), V75 (= V81), L77 (≠ H83), C82 (= C88), V83 (≠ I89), C85 (= C91), K86 (≠ G92), C88 (= C94), C92 (= C98), I97 (≠ P103), A140 (≠ M117), K142 (= K119), C143 (= C120), D144 (≠ T121), L145 (≠ F122), C146 (= C123), P153 (= P150), C155 (= C152), C159 (= C156), P160 (≠ S157), T161 (= T158), L164 (= L161)
1kqfB Formate dehydrogenase n from e. Coli (see paper)
24% identity, 81% coverage: 2:179/221 of query aligns to 27:201/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (= Y93)
- binding iron/sulfur cluster: K31 (≠ F6), C38 (= C13), I39 (= I14), G40 (≠ E15), C41 (= C16), K42 (≠ N17), C44 (= C19), C48 (= C23), N52 (≠ H27), T77 (≠ G32), M79 (≠ N34), C99 (= C56), M100 (= M57), H101 (= H58), C102 (= C59), P105 (≠ A62), C107 (= C64), C111 (= C68), P112 (= P69), I117 (≠ F73), V125 (= V81), C132 (= C88), I133 (= I89), G134 (= G90), C135 (= C91), G136 (= G92), Y137 (= Y93), C138 (= C94), C142 (= C98), I146 (≠ A102), P147 (= P103), V156 (≠ M117), K158 (= K119), C159 (= C120), L161 (≠ F122), C162 (= C123), P172 (= P150), C174 (= C152), C178 (= C156), P179 (≠ S157), I183 (≠ L161)
Sites not aligning to the query:
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
24% identity, 81% coverage: 2:179/221 of query aligns to 28:202/294 of P0AAJ3
- C39 (= C13) binding
- C42 (= C16) binding
- C45 (= C19) binding
- C49 (= C23) binding
- C100 (= C56) binding
- C103 (= C59) binding
- C108 (= C64) binding
- C112 (= C68) binding
- C133 (= C88) binding
- C136 (= C91) binding
- C139 (= C94) binding
- C143 (= C98) binding
- C160 (= C120) binding
- C163 (= C123) binding
- C175 (= C152) binding
- C179 (= C156) binding
6x6uB Wor5 from pyrococcus furiosus, taurine-bound (see paper)
30% identity, 57% coverage: 3:128/221 of query aligns to 2:120/167 of 6x6uB
- binding phosphate ion: D10 (≠ E11)
- binding iron/sulfur cluster: C12 (= C13), S13 (≠ I14), C15 (= C16), R16 (≠ N17), C18 (= C19), C22 (= C23), H26 (= H27), R36 (= R35), I37 (≠ R36), V39 (= V38), C52 (= C56), V53 (≠ M57), C55 (= C59), P59 (= P63), C60 (= C64), C64 (= C68), P65 (= P69), L69 (≠ F73), C85 (= C88), I86 (= I89), T87 (≠ G90), C88 (= C91), G89 (= G92), C91 (= C94), C95 (= C98), P100 (= P103), C112 (= C120), D113 (≠ T121), L114 (≠ F122), C115 (= C123), P119 (= P127)
Sites not aligning to the query:
8c0zC Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
30% identity, 54% coverage: 9:127/221 of query aligns to 8:120/158 of 8c0zC
- binding iron/sulfur cluster: C12 (= C13), T13 (≠ I14), C15 (= C16), C18 (= C19), C22 (= C23), C53 (= C56), C56 (= C59), C61 (= C64), C65 (= C68), I70 (≠ F73), C86 (= C88), C89 (= C91), C92 (= C94), C96 (= C98), T100 (≠ A102), K112 (= K119), C113 (= C120), C116 (= C123)
Sites not aligning to the query:
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
36% identity, 43% coverage: 12:105/221 of query aligns to 13:115/183 of 7qv7B
- binding iron/sulfur cluster: C14 (= C13), G16 (≠ E15), C17 (= C16), K18 (≠ N17), A19 (≠ S18), C20 (= C19), C24 (= C23), H28 (vs. gap), R48 (≠ V41), C63 (= C56), R64 (≠ M57), H65 (= H58), C66 (= C59), A69 (= A62), C71 (= C64), C75 (= C68), A79 (≠ C72), I80 (≠ F73), C94 (= C88), I95 (= I89), C97 (= C91), C100 (= C94), C104 (= C98), I109 (vs. gap)
Sites not aligning to the query:
6btmB Structure of alternative complex iii from flavobacterium johnsoniae (wild type) (see paper)
25% identity, 52% coverage: 9:123/221 of query aligns to 689:868/948 of 6btmB
- binding fe3-s4 cluster: C789 (= C68), C809 (= C88), V810 (≠ I89), T812 (≠ C91), C815 (= C94), M862 (= M117)
- binding iron/sulfur cluster: C777 (= C56), Q778 (≠ M57), C780 (= C59), C785 (= C64), N802 (≠ V81), C819 (= C98), R824 (≠ P103)
Sites not aligning to the query:
3egwB The crystal structure of the narghi mutant narh - c16a
41% identity, 31% coverage: 56:123/221 of query aligns to 184:247/509 of 3egwB
- binding fe3-s4 cluster: C196 (= C68), S198 (≠ V70), I201 (≠ F73), C217 (= C88), R218 (≠ I89), G219 (= G90), W220 (≠ C91), R221 (≠ G92), C223 (= C94), S241 (≠ M117)
- binding protoporphyrin ix containing fe: W220 (≠ C91), R221 (≠ G92)
- binding iron/sulfur cluster: C184 (= C56), E185 (≠ M57), H186 (= H58), C187 (= C59), P190 (≠ A62), C192 (= C64), C227 (= C98), I232 (≠ P103), K243 (= K119), C244 (= C120), F246 (= F122), C247 (= C123)
Sites not aligning to the query:
- binding fe3-s4 cluster: 17, 18, 19, 20, 22, 181, 263, 265, 268
- binding protoporphyrin ix containing fe: 88, 89
- binding iron/sulfur cluster: 26, 30, 41, 42, 257, 259
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 31% coverage: 56:123/221 of query aligns to 184:247/512 of P11349
- C184 (= C56) binding
- C187 (= C59) binding
- C192 (= C64) binding
- C196 (= C68) binding
- C217 (= C88) binding
- C223 (= C94) binding
- C227 (= C98) binding
- C244 (= C120) binding
- C247 (= C123) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
- 259 binding
- 263 binding
4v4cB Pyrogallol hydroxytransferase small subunit (see paper)
27% identity, 56% coverage: 1:124/221 of query aligns to 1:130/274 of 4v4cB
- binding calcium ion: I61 (≠ V46), N62 (≠ G47)
- binding iron/sulfur cluster: C13 (= C13), Q14 (≠ I14), D15 (≠ E15), C16 (= C16), N17 (= N17), N18 (≠ S18), C19 (= C19), C23 (= C23), C68 (= C56), M69 (= M57), H70 (= H58), C71 (= C59), C76 (= C64), V92 (= V81), C109 (= C98), V113 (≠ A102), C126 (= C120), M128 (≠ F122), C129 (= C123)
Sites not aligning to the query:
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
35% identity, 35% coverage: 52:129/221 of query aligns to 132:205/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C68), T150 (≠ V70), I153 (≠ F73), C169 (= C88), K170 (≠ I89), G171 (= G90), H172 (≠ C91), R173 (≠ G92), H174 (≠ Y93), C175 (= C94), S193 (≠ M117)
- binding protoporphyrin ix containing fe: T150 (≠ V70), K170 (≠ I89), H172 (≠ C91)
- binding iron/sulfur cluster: M135 (≠ A55), C136 (= C56), N137 (≠ M57), H138 (= H58), C139 (= C59), P142 (≠ A62), C144 (= C64), V162 (= V81), C179 (= C98), A183 (= A102), I184 (≠ P103), K195 (= K119), C196 (= C120), I197 (≠ T121), L198 (≠ F122), C199 (= C123)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41, 209, 211, 215, 219, 220
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
27% identity, 57% coverage: 56:182/221 of query aligns to 133:237/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C68), I150 (≠ F73), C166 (= C88), K167 (≠ I89), G168 (= G90), A169 (≠ C91), Q170 (≠ G92), A171 (≠ Y93), C172 (= C94), A190 (≠ M117)
- binding iron/sulfur cluster: C133 (= C56), N134 (≠ M57), C136 (= C59), P139 (≠ A62), C141 (= C64), C176 (= C98), C193 (= C120), G195 (≠ F122), C196 (= C123), C208 (= C152), C212 (= C156), V213 (≠ S157), G214 (≠ T158)
Sites not aligning to the query:
- binding iron/sulfur cluster: 17, 18, 19, 20, 21, 23, 27, 31, 43, 45, 130
Query Sequence
>RR42_RS15975 FitnessBrowser__Cup4G11:RR42_RS15975
MARMKFICDAERCIECNSCVTACKNEHEVPWGVNRRRVVTVNDGIVGAEKSISVACMHCS
DAPCMAVCPVDCFYRTEDGVVLHDKDICIGCGYCSYACPFGAPQFPSAGTFGVRGKMDKC
TFCAGGPEKNGSDEEFEKYGRNRLAEGKLPLCAEMCSTKALLGGDGDVIADILRNRVIKR
GKGGDVFGWGTAYGNKGATQGAAGAGAAPPAAPPASGAQPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory