SitesBLAST
Comparing RR42_RS16130 FitnessBrowser__Cup4G11:RR42_RS16130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 81% coverage: 13:238/278 of query aligns to 11:236/265 of P07821
- K50 (= K52) mutation to Q: Lack of activity.
- D172 (= D174) mutation to E: Lack of activity.
- E173 (= E175) mutation to A: Lack of activity.
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 76% coverage: 29:238/278 of query aligns to 16:216/348 of 3d31A
Sites not aligning to the query:
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
36% identity, 77% coverage: 32:246/278 of query aligns to 18:228/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
34% identity, 84% coverage: 32:264/278 of query aligns to 18:246/248 of 4fi3C
- binding phosphoaminophosphonic acid-adenylate ester: N34 (= N48), G35 (= G49), G37 (= G51), K38 (= K52), S39 (= S53), T40 (= T54), R121 (= R145), Q125 (≠ T149), S127 (= S151), G129 (= G153), E130 (= E154), Q158 (≠ E175)
- binding magnesium ion: S39 (= S53), Q79 (= Q94)
Sites not aligning to the query:
2ixfA Crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant) (see paper)
32% identity, 79% coverage: 28:247/278 of query aligns to 33:252/255 of 2ixfA
- binding adenosine-5'-triphosphate: V33 (≠ L28), N53 (= N48), G54 (= G49), S55 (≠ V50), G56 (= G51), K57 (= K52), S58 (= S53), T59 (= T54), N154 (≠ L148), S157 (= S151), G159 (= G153), Q160 (≠ E154), H214 (= H208)
Sites not aligning to the query:
3ozxA Crystal structure of abce1 of sulfolubus solfataricus (-fes domain)
31% identity, 63% coverage: 37:212/278 of query aligns to 281:437/514 of 3ozxA
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 8, 13, 33, 34, 36, 37, 38, 39, 214, 268, 271, 453
- binding magnesium ion: 38, 92
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
35% identity, 66% coverage: 10:192/278 of query aligns to 327:509/585 of 6tejB
P36370 Antigen peptide transporter 1; APT1; ATP-binding cassette sub-family B member 2; Peptide transporter TAP1; EC 7.4.2.14 from Rattus norvegicus (Rat) (see 2 papers)
31% identity, 82% coverage: 28:256/278 of query aligns to 497:725/725 of P36370
- 515:523 (vs. 46:54, 89% identical) binding
- S522 (= S53) binding
- 618:624 (vs. 148:154, 57% identical) binding
- SG 621:622 (= SG 151:152) mutation to AV: Complete loss of ATPase activity; when associated with N-645. Impairs peptide loading onto MHCI.
- D645 (≠ E175) mutation to E: Increases ATPase activity by 8-fold; when associated with H-678.; mutation to N: Complete loss of ATPase activity; when associated with A-621 and V-622.; mutation to Q: Impairs ATPase activity; when associated with H-678.
- D651 (= D181) mutation D->A,N: Decreases ATP-driven nucleotide binding domain (NBD) dimerization.
- Q678 (≠ H208) binding ; mutation to H: Increases ATPase activity by 8-fold; when associated with E-645. Impairs ATPase activity; when associated with Q-645.
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 68% coverage: 28:217/278 of query aligns to 21:210/222 of 7arlD
3bk7A Structure of the complete abce1/rnaase-l inhibitor protein from pyrococcus abysii (see paper)
30% identity, 72% coverage: 35:234/278 of query aligns to 364:541/593 of 3bk7A
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 87, 92, 112, 113, 114, 115, 116, 117, 118, 292, 353
- binding iron/sulfur cluster: 15, 16, 20, 25, 29, 30, 38, 39, 55, 56, 57, 58, 59, 61, 65, 70
7mdyC Lolcde nucleotide-bound
33% identity, 68% coverage: 28:217/278 of query aligns to 21:210/226 of 7mdyC
- binding adp orthovanadate: G42 (= G49), S43 (≠ V50), G44 (= G51), K45 (= K52), S46 (= S53), T47 (= T54), Q91 (= Q94), H138 (≠ R145), E142 (≠ T149), S144 (= S151), G145 (= G152), G146 (= G153), E168 (= E175), N172 (≠ H179), H201 (= H208)
- binding magnesium ion: S46 (= S53), Q91 (= Q94)
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 68% coverage: 28:217/278 of query aligns to 24:213/233 of P75957
- G42 (= G46) mutation to D: Loss of lipoprotein release when overexpressed.
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
32% identity, 68% coverage: 28:217/278 of query aligns to 23:212/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (≠ L28), S43 (≠ N48), G44 (= G49), G46 (= G51), K47 (= K52), S48 (= S53), T49 (= T54), Q93 (= Q94), R137 (≠ L142), H140 (≠ R145), E144 (≠ T149), S146 (= S151), G148 (= G153), E149 (= E154), H203 (= H208)
- binding magnesium ion: S48 (= S53), Q93 (= Q94)
P45844 ATP-binding cassette sub-family G member 1; ATP-binding cassette transporter 8; White protein homolog; EC 7.6.2.- from Homo sapiens (Human) (see 6 papers)
31% identity, 67% coverage: 22:206/278 of query aligns to 94:273/678 of P45844
- K124 (= K52) mutation to M: Affects ATP binding. Does not affect efflux of 7beta-hydroxycholesterol. Does not affect localization at plasma membrane. Does not affect homodimerization. Decreases cholesterol and phospholipids efflux. Does not affect heretodimerization with ABCG4.
- C154 (≠ A86) modified: S-palmitoyl cysteine; mutation to A: No significant effect.
Sites not aligning to the query:
- 30 modified: S-palmitoyl cysteine; C→A: No significant effect.
- 315 modified: S-palmitoyl cysteine; mutation C->A,S: Significantly decreases ABCG1-mediated cholesterol efflux.
- 394 modified: S-palmitoyl cysteine; C→A: No significant effect.
- 406 modified: S-palmitoyl cysteine; C→A: No significant effect.
- 491 Y→A: Significantly reduces interaction with CAV1; when associated with A-493. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-493.
- 493 Y→A: Significantly reduces interaction with CAV1; when associated with A-491. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-491.
- 498 Y→A: Significantly reduces interaction with CAV1; when associated with A-499. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-499. Affects subcellular location at plasma membrane; when associated with A-499. Affects ABCG1 traffincking to the plasma membrane; when associated with A-499.; Y→F: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-499.; Y→I: Dramatically reduces the ability of ABCG1 to mediate cholesterol efflux; when associated with I-499.; Y→W: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-499.
- 499 Y→A: Significantly reduces interaction with CAV1; when associated with A-498. Significantly reduces ABCG1-mediated cholesterol efflux; when associated with A-498. Affects subcellular location at plasma membrane; when associated with A-498. Affects ABCG1 traffincking to the plasma membrane; when associated with A-498.; Y→F: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-498.; Y→I: Dramatically reduces the ability of ABCG1 to mediate cholesterol efflux; when associated with I-498.; Y→W: Does not affect ABCG1-mediated cholesterol efflux; when associated with I-498.
- 668 natural variant: F -> L
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
34% identity, 68% coverage: 28:215/278 of query aligns to 23:209/650 of 5ws4A
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
35% identity, 77% coverage: 24:237/278 of query aligns to 330:540/865 of O65934
- E479 (= E175) mutation to Q: Loss of ATPase activity.
Sites not aligning to the query:
- 33 R→A: Strong decrease in phosphorylation.
- 47 S→A: Strong decrease in phosphorylation. Lack of interaction with PknF. Attenuates growth in macrophages.
- 69 N→A: Strong decrease in phosphorylation.
- 152 modified: Phosphothreonine; T→A: Lack of phosphorylation. Attenuates growth in macrophages and in mice; when associated with A-210.
- 210 modified: Phosphothreonine; T→A: Lack of phosphorylation. Attenuates growth in macrophages and in mice; when associated with A-152.
- 234 R→A: Strong decrease in phosphorylation.
- 248 S→A: Strong decrease in phosphorylation. Decreases interaction with PknF.
- 270 N→A: Strong decrease in phosphorylation.
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 88% coverage: 7:252/278 of query aligns to 3:244/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (≠ L21), V18 (≠ A25), A20 (= A27), N40 (= N48), G41 (= G49), G43 (= G51), K44 (= K52), S45 (= S53), T46 (= T54), Q88 (≠ P93), H139 (≠ L148), M140 (≠ T149), L141 (= L150), S142 (= S151), G144 (= G153), Q145 (≠ E154), Q166 (≠ E175), H198 (= H208)
- binding magnesium ion: S45 (= S53), Q88 (≠ P93)
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
31% identity, 76% coverage: 27:238/278 of query aligns to 473:684/715 of Q9JI39
- G497 (= G51) mutation to A: Decreases ATP binding about 50%.
- K498 (= K52) mutation to R: Decreases ATP binding about 50%.
- C547 (≠ M102) modified: S-glutathionyl cysteine; mutation to A: Does not affect ABCB10 glutathionylation.
- G602 (= G153) mutation to D: Affects ATP hydrolysis but not binding.; mutation to V: Affects ATP hydrolysis but not binding.
- E624 (= E175) mutation to Q: Affects ATP hydrolysis but not binding.
- C675 (= C229) mutation to A: Prevents ABCB10 glutathionylation.
Sites not aligning to the query:
- 1:82 modified: transit peptide, Mitochondrion
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
33% identity, 69% coverage: 29:220/278 of query aligns to 24:211/218 of 7w78A
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
33% identity, 69% coverage: 29:220/278 of query aligns to 24:211/216 of 7w79A
- binding adenosine-5'-triphosphate: S43 (≠ N48), G44 (= G49), S45 (≠ V50), G46 (= G51), K47 (= K52), S48 (= S53), T49 (= T54)
- binding manganese (ii) ion: E30 (≠ S35), S48 (= S53), Q88 (= Q94), E163 (= E175), H196 (= H208)
Sites not aligning to the query:
Query Sequence
>RR42_RS16130 FitnessBrowser__Cup4G11:RR42_RS16130
MPTWNEPVCACPSLVLQSLQLRAGARALLDGLSLSMQAGELWCVVGPNGVGKSTLMSVLA
GLRKPDGGVVLLDGRAPLETPPAALALRRAYLPQAVHDTFSMSVRDAVAVGRHPHLSGWG
WAGREDDAVVAAVMREMDLDALAGRDVLTLSGGERQRVSLAATLAQQAPLLMLDEPAAHL
DLRHQIMVLETLARLTRAGRHAIVVILHDLNLARRYATHALLLAEDGLCLHGPAAQVLTP
AHCSHALRTPIVSVSDGRHTALIADGAPSPAPDETQHD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory