Comparing RR42_RS16370 FitnessBrowser__Cup4G11:RR42_RS16370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
63% identity, 92% coverage: 20:259/260 of query aligns to 3:241/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
59% identity, 92% coverage: 20:258/260 of query aligns to 2:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
57% identity, 92% coverage: 20:258/260 of query aligns to 4:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
57% identity, 92% coverage: 20:258/260 of query aligns to 4:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
57% identity, 92% coverage: 20:258/260 of query aligns to 4:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
57% identity, 92% coverage: 20:258/260 of query aligns to 4:242/242 of 2oljA
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
47% identity, 88% coverage: 25:254/260 of query aligns to 8:249/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 88% coverage: 25:254/260 of query aligns to 12:253/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 92% coverage: 20:259/260 of query aligns to 2:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 92% coverage: 20:259/260 of query aligns to 3:247/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 92% coverage: 20:259/260 of query aligns to 3:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 92% coverage: 20:259/260 of query aligns to 3:247/344 of 3tuiC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 92% coverage: 18:255/260 of query aligns to 5:244/375 of 2d62A
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 92% coverage: 18:255/260 of query aligns to 1:234/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 92% coverage: 18:255/260 of query aligns to 1:234/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 92% coverage: 18:255/260 of query aligns to 1:234/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 92% coverage: 18:255/260 of query aligns to 1:234/371 of 3puvA
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 92% coverage: 18:255/260 of query aligns to 1:234/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
36% identity, 92% coverage: 18:255/260 of query aligns to 2:235/371 of P68187
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 92% coverage: 18:255/260 of query aligns to 2:235/369 of P19566
Sites not aligning to the query:
>RR42_RS16370 FitnessBrowser__Cup4G11:RR42_RS16370
MRALENNPPAQDAASQPATIELRRVSKWFGETQVLSNIDMRVQRGERIVICGPSGSGKST
MIRCINRLEEHQQGEILVEGVSLTKSPRNISFVRREVGMVFQQFNLFPHLSVLQNLMIAP
MKIRGIKKKEAEETARHFLERVRIGDKADRYPAQLSGGQQQRVAIARALCMKPKMMLFDE
PTSALDPEMIKEVLDVMMQLARDGMTMVCVTHEMGFARTVADRILFMDKGEIVEEAQPEA
FFSMPKSERARAFLGQILNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory