SitesBLAST
Comparing RR42_RS16375 FitnessBrowser__Cup4G11:RR42_RS16375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
39% identity, 100% coverage: 1:256/257 of query aligns to 2:254/255 of 5itvA
- active site: G18 (= G17), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (= T65), I63 (≠ V67), N89 (≠ D93), G91 (≠ A95), T139 (≠ V148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (= G194), I186 (≠ K195), I187 (= I196)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 98% coverage: 4:256/257 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G17), S142 (= S150), Y155 (= Y163), K159 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (= I38), A61 (≠ T65), D62 (= D66), T63 (≠ V67), N89 (≠ D93), A90 (= A94), M140 (≠ V148), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), A186 (≠ G194), Y187 (≠ K195), I188 (= I196), L192 (≠ A204)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
39% identity, 100% coverage: 1:256/257 of query aligns to 2:226/227 of 5itvD
- active site: G18 (= G17), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (= T65), D62 (= D66), I63 (≠ V67), N89 (≠ D93), T139 (≠ V148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (= G194), I187 (= I196)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 97% coverage: 4:253/257 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G17), S151 (= S150), Y164 (= Y163), K168 (= K167)
- binding beta-D-glucopyranose: E102 (≠ S97), S151 (= S150), H153 (= H152), W158 (≠ A157), Y164 (= Y163), N202 (≠ K200), K205 (≠ P203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), T23 (≠ S16), G24 (= G17), L25 (≠ I18), Y45 (≠ I38), D71 (= D66), V72 (= V67), N98 (≠ D93), A99 (= A94), G100 (≠ A95), V101 (≠ I96), M149 (≠ V148), S151 (= S150), Y164 (= Y163), K168 (= K167), P194 (= P193), G195 (= G194), M197 (≠ I196), T199 (= T198), P200 (≠ G199), I201 (vs. gap), N202 (≠ K200)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 99% coverage: 1:255/257 of query aligns to 2:243/244 of 4nbuB
- active site: G18 (= G17), N111 (= N117), S139 (= S150), Q149 (≠ N160), Y152 (= Y163), K156 (= K167)
- binding acetoacetyl-coenzyme a: D93 (≠ G99), K98 (≠ E104), S139 (= S150), N146 (≠ A157), V147 (≠ P158), Q149 (≠ N160), Y152 (= Y163), F184 (≠ K195), M189 (≠ K200), K200 (≠ Y212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ I38), V59 (≠ T65), D60 (= D66), V61 (= V67), N87 (≠ D93), A88 (= A94), G89 (≠ A95), I90 (= I96), T137 (≠ V148), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), F184 (≠ K195), T185 (≠ I196), T187 (= T198), M189 (≠ K200)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 97% coverage: 4:253/257 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G17), S142 (= S150), Q152 (≠ N160), Y155 (= Y163), K159 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ A36), Y36 (≠ T39), N37 (≠ E40), G38 (≠ T41), S39 (≠ V42), N63 (≠ D66), V64 (= V67), N90 (≠ D93), A91 (= A94), I93 (= I96), I113 (≠ V116), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (= I196), T190 (vs. gap)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 98% coverage: 4:256/257 of query aligns to 3:247/248 of 4urfB
- active site: G16 (= G17), S142 (= S150), I152 (≠ N160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M219), R211 (≠ P220), R212 (= R221)
- binding bicarbonate ion: I92 (= I96), G94 (≠ A98), R109 (= R112), R179 (≠ I187), S228 (= S237)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (= I38), D62 (= D66), T63 (≠ V67), N89 (≠ D93), A90 (= A94), G91 (≠ A95), I140 (≠ V148), Y155 (= Y163), K159 (= K167), P185 (= P193), A186 (≠ G194), I188 (= I196), T190 (= T198)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 98% coverage: 4:256/257 of query aligns to 3:247/248 of 4urfA
- active site: G16 (= G17), S142 (= S150), I152 (≠ N160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I96), S93 (= S97), G94 (≠ A98), E95 (≠ G99), T97 (≠ K100), E101 (= E104), T103 (= T106), Q106 (≠ E109), R109 (= R112), S175 (≠ D183), G177 (= G185)
- binding magnesium ion: S237 (≠ E246), Y238 (≠ N247)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (= I38), W41 (≠ G45), D62 (= D66), T63 (≠ V67), N89 (≠ D93), A90 (= A94), G91 (≠ A95), I140 (≠ V148), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (= I196), T190 (= T198)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 98% coverage: 4:256/257 of query aligns to 3:247/248 of 4ureB
- active site: G16 (= G17), S142 (= S150), I152 (≠ N160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S16), G16 (= G17), I17 (= I18), N89 (≠ D93), G91 (≠ A95), Y155 (= Y163), P185 (= P193), A186 (≠ G194)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 98% coverage: 2:253/257 of query aligns to 3:249/261 of 1g6kA
- active site: G18 (= G17), S145 (= S150), Y158 (= Y163), K162 (= K167)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S16), G18 (= G17), L19 (≠ I18), R39 (≠ I38), D65 (= D66), V66 (= V67), N92 (≠ D93), A93 (= A94), G94 (≠ A95), M143 (≠ V148), S145 (= S150), Y158 (= Y163), P188 (= P193), G189 (= G194), I191 (= I196), T193 (= T198)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 98% coverage: 2:253/257 of query aligns to 3:249/261 of P40288
- 11:35 (vs. 10:34, 44% identical) binding
- E96 (≠ S97) mutation E->A,G,K: Heat stable.
- D108 (≠ E109) mutation to N: Heat stable.
- V112 (= V113) mutation to A: Heat stable.
- E133 (≠ K134) mutation to K: Heat stable.
- V183 (≠ C188) mutation to I: Heat stable.
- P194 (≠ G199) mutation to Q: Heat stable.
- E210 (= E214) mutation to K: Heat stable.
- Y217 (≠ R221) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
42% identity, 98% coverage: 6:257/257 of query aligns to 5:239/240 of 2d1yA
- active site: G16 (= G17), S135 (= S150), N145 (= N160), Y148 (= Y163), K152 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ S16), I17 (= I18), D36 (= D37), L37 (= L53), R38 (= R54), V55 (≠ T65), D56 (= D66), L57 (≠ V67), N83 (≠ D93), A84 (= A94), A85 (= A95), I86 (= I96), V133 (= V148), S135 (= S150), Y148 (= Y163), K152 (= K167), P178 (= P193), G179 (= G194), I181 (= I196), T183 (= T198), A185 (≠ K200), V186 (≠ A204)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
40% identity, 96% coverage: 10:256/257 of query aligns to 6:249/250 of 2cfcA
- active site: G13 (= G17), S142 (= S150), Y155 (= Y163), K159 (= K167)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ A157), R152 (≠ N160), Y155 (= Y163), W195 (≠ P203), R196 (≠ A204)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), S12 (= S16), G13 (= G17), N14 (≠ I18), D33 (= D37), L34 (≠ I38), A59 (≠ T65), D60 (= D66), V61 (= V67), N87 (≠ D93), A88 (= A94), G89 (≠ A95), I140 (≠ V148), P185 (= P193), G186 (= G194), M187 (≠ K195), I188 (= I196), T190 (= T198), P191 (≠ G199), M192 (≠ K200), T193 (≠ A201)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
40% identity, 96% coverage: 10:256/257 of query aligns to 6:249/250 of Q56840
- SGN 12:14 (≠ SGI 16:18) binding
- D33 (= D37) binding
- DV 60:61 (= DV 66:67) binding
- N87 (≠ D93) binding
- S142 (= S150) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ N160) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y163) mutation Y->E,F: Loss of activity.
- K159 (= K167) mutation to A: Loss of activity.
- R179 (≠ I187) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IVTGK 196:200) binding
- WR 195:196 (≠ PA 203:204) binding
- R196 (≠ A204) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (vs. gap) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R216) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
36% identity, 98% coverage: 2:253/257 of query aligns to 1:243/247 of 2ewmB
- active site: G16 (= G17), S139 (= S150), Y149 (≠ N160), Y152 (= Y163), K156 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (= D37), L37 (≠ I38), C59 (≠ T65), D60 (= D66), V61 (= V67), N87 (≠ D93), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), S183 (≠ G194), L184 (≠ K195), V185 (≠ I196), T189 (≠ K200)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
36% identity, 98% coverage: 2:253/257 of query aligns to 3:245/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
37% identity, 98% coverage: 2:253/257 of query aligns to 3:250/254 of 4fn4A
- active site: G18 (= G17), S144 (= S150), Y157 (= Y163), K161 (= K167), S202 (≠ A208)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), E38 (≠ D37), L39 (≠ I38), R43 (vs. gap), A63 (≠ T65), D64 (= D66), V65 (= V67), N91 (≠ D93), G93 (≠ A95), I94 (= I96), T142 (≠ V148), S144 (= S150), Y157 (= Y163), K161 (= K167), P187 (= P193), V190 (≠ I196), T192 (= T198), N193 (≠ G199), I194 (≠ K200)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 99% coverage: 4:257/257 of query aligns to 5:249/249 of 3uf0A
- active site: G18 (= G17), S141 (= S150), V151 (≠ N160), Y154 (= Y163), K158 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), R39 (≠ I38), D63 (= D66), L64 (≠ V67), N89 (≠ D93), G91 (≠ A95), I92 (= I96), I139 (≠ V148), A140 (≠ S149), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (= G194), V187 (≠ I196), T189 (= T198), N191 (≠ S206), T192 (≠ A207)
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
37% identity, 89% coverage: 28:256/257 of query aligns to 27:247/248 of 4gh5A
- active site: N113 (= N117), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), L37 (≠ I38), A61 (≠ T65), D62 (= D66), V63 (= V67), N89 (≠ D93), A90 (= A94), V112 (= V116), F139 (≠ V148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), V187 (≠ I196), T190 (≠ G199), G191 (≠ K200), M192 (≠ A201)
Sites not aligning to the query:
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 97% coverage: 4:253/257 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (= D37), I36 (= I38), I62 (≠ V67), N88 (≠ D93), G90 (≠ A95), I138 (≠ V148), S140 (= S150), Y152 (= Y163), K156 (= K167), I185 (= I196)
Query Sequence
>RR42_RS16375 FitnessBrowser__Cup4G11:RR42_RS16375
MRRLEGKSVLVTGASSGIGRAIALRFGREGARLVLADITETVREGGVPTADVLRLEGHEV
EFIRTDVAQESDADAAVAHAVRRYGRLDVLVNDAAISAGKPLTETTIDEWNRVMAVNLTG
VFLMSRAAVSAMLKQEVCREARGRIVNVSSQHGMVCAPRNVAYGTSKAGVVYLTRQIAVD
YADQGIICNAVAPGKIVTGKAGPAASAAALEYSEARTPMPRLGRPDDVASAALFLASDEA
TFITGENLMIDGGWMAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory