Comparing RR42_RS16615 FitnessBrowser__Cup4G11:RR42_RS16615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
40% identity, 97% coverage: 1:322/331 of query aligns to 7:336/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
28% identity, 56% coverage: 110:294/331 of query aligns to 94:270/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
28% identity, 56% coverage: 110:294/331 of query aligns to 94:270/290 of 8gsrA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
25% identity, 71% coverage: 31:265/331 of query aligns to 39:266/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
25% identity, 71% coverage: 31:265/331 of query aligns to 40:267/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
29% identity, 48% coverage: 108:267/331 of query aligns to 90:242/277 of 6iymA
>RR42_RS16615 FitnessBrowser__Cup4G11:RR42_RS16615
MKLGTIDNWTRDGALALADTRSGQAIVVSHIVGTMQEAIDSWSKYSAPLHEEYRRLQEGT
LCATVPISELRWRAPLPRAYQLLDGGGYRPHLELGFSMRKQSFPEEMAEKPSFYQSVSDS
ILGPTEDFILGTDDLGTDFEAELVVVTNDVKQMATKVEGANGILLVGLMNDISLRLTQRV
EHARGFGFYHCKPKKTLAPFLVTPDELGEHWINFKVSLPVEVRWNGEVFGCPDGAEHMMF
DFATLVSEASRHRKLTAGTIIGGGTVATYDRDTFGQCCILERRALDILEFGEERTSWLKP
DDRVRIEVRMPDGSTVFGAIDQVYRVTPWGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory