Comparing RR42_RS16670 FitnessBrowser__Cup4G11:RR42_RS16670 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00014 Cytochrome c from Macropus giganteus (Eastern gray kangaroo) (see paper)
45% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P00014
Sites not aligning to the query:
P00069 Cytochrome c from Guizotia abyssinica (Niger) (Ramtilla)
45% identity, 83% coverage: 20:120/122 of query aligns to 8:108/111 of P00069
Sites not aligning to the query:
P00053 Cytochrome c from Cannabis sativa (Hemp) (Marijuana)
45% identity, 80% coverage: 21:118/122 of query aligns to 9:106/111 of P00053
Sites not aligning to the query:
P00051 Cytochrome c from Cucurbita maxima (Pumpkin) (Winter squash) (see paper)
45% identity, 80% coverage: 21:118/122 of query aligns to 9:106/111 of P00051
Sites not aligning to the query:
P99999 Cytochrome c from Homo sapiens (Human) (see 4 papers)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P99999
Sites not aligning to the query:
P00018 Cytochrome c from Dromaius novaehollandiae (Emu) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P00018
Sites not aligning to the query:
5dfsA Crystal structure of spider monkey cytochromE C at 1.15 angstrom (see paper)
42% identity, 80% coverage: 21:118/122 of query aligns to 1:98/104 of 5dfsA
P00008 Cytochrome c from Oryctolagus cuniculus (Rabbit) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P00008
Sites not aligning to the query:
P68098 Cytochrome c from Lama guanicoe (Guanaco) (Lama glama guanicoe) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P68098
Sites not aligning to the query:
P68100 Cytochrome c from Eschrichtius robustus (California gray whale) (Eschrichtius gibbosus) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P68100
Sites not aligning to the query:
P68099 Cytochrome c from Camelus dromedarius (Dromedary) (Arabian camel) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P68099
Sites not aligning to the query:
P00022 Cytochrome c from Chelydra serpentina (Snapping turtle) (Testudo serpentina) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P00022
Sites not aligning to the query:
P00007 Cytochrome c from Hippopotamus amphibius (Hippopotamus) (see paper)
43% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P00007
Sites not aligning to the query:
P00052 Cytochrome c from Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) (see paper)
44% identity, 80% coverage: 21:118/122 of query aligns to 9:106/111 of P00052
Sites not aligning to the query:
P00067 Cytochrome c from Tropaeolum majus (Common nasturtium) (Indian cress) (see paper)
44% identity, 81% coverage: 20:118/122 of query aligns to 8:106/111 of P00067
Sites not aligning to the query:
P68519 Cytochrome c from Crotalus viridis viridis (Prairie rattlesnake) (see paper)
40% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P68519
Sites not aligning to the query:
P68518 Cytochrome c from Crotalus atrox (Western diamondback rattlesnake) (see paper)
40% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P68518
Sites not aligning to the query:
P68517 Cytochrome c from Crotalus adamanteus (Eastern diamondback rattlesnake) (see paper)
40% identity, 80% coverage: 21:118/122 of query aligns to 2:99/105 of P68517
Sites not aligning to the query:
P62773 Cytochrome c from Brassica oleracea (Wild cabbage) (see paper)
45% identity, 80% coverage: 21:118/122 of query aligns to 9:106/111 of P62773
Sites not aligning to the query:
P62772 Cytochrome c from Brassica napus (Rape) (see paper)
45% identity, 80% coverage: 21:118/122 of query aligns to 9:106/111 of P62772
Sites not aligning to the query:
>RR42_RS16670 FitnessBrowser__Cup4G11:RR42_RS16670
MKNAALLTLALALHATAQAAGDAQAGKAVFTSKCASCHSVGPSARAAFGPQLNGIFGRVA
GGTTDYKYSPEMKKSGIVWSEKTLSAFIASPSKVVPGTRMRFWGISNERQIADLLAYLHA
YQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory