SitesBLAST
Comparing RR42_RS16765 FitnessBrowser__Cup4G11:RR42_RS16765 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
31% identity, 97% coverage: 4:494/507 of query aligns to 1:486/495 of 6udeB
- binding adenosine-5'-diphosphate: R16 (= R19), G262 (= G266), T263 (= T267), G306 (= G313), I309 (≠ L316), S323 (≠ K330), G406 (= G413), G407 (= G414), A408 (≠ L415)
- binding magnesium ion: G11 (= G14), T12 (= T15), T13 (≠ S16), S14 (≠ G17)
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
30% identity, 95% coverage: 8:490/507 of query aligns to 5:482/498 of Q5HGD2
- T12 (= T15) binding
- R16 (= R19) binding
- R82 (= R85) binding
- E83 (≠ A86) binding
- Y134 (≠ V133) binding
- D244 (= D245) binding
- Q245 (= Q246) binding
- T266 (= T267) binding
- G309 (= G313) binding
- Q313 (≠ N317) binding
- G410 (= G414) binding
- N414 (≠ S418) binding
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
30% identity, 95% coverage: 8:490/507 of query aligns to 6:483/499 of 3ge1A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
29% identity, 97% coverage: 8:498/507 of query aligns to 5:493/496 of P18157
- H230 (≠ A231) mutation to R: Increased activity.
- F232 (≠ L233) mutation to S: Increased activity.
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
29% identity, 97% coverage: 5:496/507 of query aligns to 4:493/506 of O34153
- R84 (= R85) binding
- E85 (≠ A86) binding
- Y136 (= Y139) binding
- H232 (vs. gap) modified: Phosphohistidine; by HPr; mutation to A: Loss of phosphorylation, no effect on activity.; mutation to E: Loss of phosphorylation, 2.5-fold reduced activity.; mutation to R: Loss of phosphorylation, 3.4-fold increased activity.
- D246 (= D245) binding
- Q247 (= Q246) binding
3h3nX Glycerol kinase h232r with glycerol (see paper)
29% identity, 97% coverage: 5:496/507 of query aligns to 3:492/501 of 3h3nX
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
28% identity, 100% coverage: 3:507/507 of query aligns to 2:500/502 of P0A6F3
- T14 (= T15) binding ; binding
- R18 (= R19) binding
- S59 (≠ A60) mutation to W: Abolishes inhibition of GK by FBP via disruption of the dimer-tetramer assembly reaction. Inhibition by EIIA-Glc is unchanged compared to wild type. The activity of this mutant is significantly higher than wild-type, and the Michaelis constants are increased slightly compared to wild-type.
- A66 (= A67) mutation to T: Although it completely abolishes FBP regulation and disrupts dimer-tetramer equilibrium, the crystal structure is essentially identical to the symmetric tetramer found in the FBP-bound form of the enzyme.
- R84 (= R85) binding ; binding
- E85 (≠ A86) binding ; binding
- Y136 (= Y139) binding ; binding
- G231 (≠ A230) mutation to D: Displays an increased enzymatic activity and a decreased allosteric regulation by FBP compared to wild-type. It displays a dimer form and is resistant to tetramer formation in the presence of FBP, whereas wild-type dimers are converted into inactive tetramers in the presence of FBP.
- K233 (≠ L232) modified: N6-malonyllysine
- G235 (= G234) binding
- R237 (≠ D236) binding ; mutation to A: Drastically reduces inhibition of GK by FBP and lowers, but did not eliminate, the ability of FBP to promote tetramer association.
- D246 (= D245) binding ; binding
- Q247 (= Q246) binding
- T268 (= T267) binding
- G305 (≠ T307) mutation to S: In glpK22; abolishes glucose control of glycerol utilization.
- G311 (= G313) binding
- G412 (= G414) binding
- N416 (≠ S418) binding
- I475 (≠ L478) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. It increases the affinity for FBP about fivefold.
- E479 (≠ Q482) binding
- R480 (= R483) mutation to D: It decreases Vmax to about 10% of the wild-type value and the affinity for substrate is increased about two- to fourfold. This mutation decreases the catalytic activity in a manner that is analogous to that obtained upon EIIA-Glc binding. Regulation by FBP is not affected by this substitution. No inhibition by EIIA-Glc is observed, which is consistent with a decrease in affinity for EIIA-Glc of about 250-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
28% identity, 96% coverage: 8:496/507 of query aligns to 7:492/501 of O34154
- H231 (vs. gap) modified: Phosphohistidine; by HPr
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
30% identity, 97% coverage: 8:498/507 of query aligns to 5:494/497 of O86033
- R82 (= R85) binding
- E83 (≠ A86) binding
- Y134 (= Y139) binding
- D243 (= D245) binding
- Q244 (= Q246) binding
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
28% identity, 99% coverage: 5:507/507 of query aligns to 2:494/494 of 1gllO
- binding phosphomethylphosphonic acid adenylate ester: T12 (= T15), T13 (≠ S16), G261 (= G266), T262 (= T267), G305 (= G313), I308 (≠ L316), Q309 (≠ N317), A321 (= A329), G406 (= G414), N410 (≠ S418)
- binding glycerol: R82 (= R85), E83 (≠ A86), Y134 (= Y139), D240 (= D245), Q241 (= Q246), F265 (= F270)
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
28% identity, 99% coverage: 5:507/507 of query aligns to 2:494/494 of 1gljO
- binding gamma-arsono-beta, gamma-methyleneadenosine-5'-diphosphate: T12 (= T15), T13 (≠ S16), G261 (= G266), T262 (= T267), G305 (= G313), Q309 (≠ N317), A321 (= A329), G406 (= G414), A407 (≠ L415)
- binding glycerol: R82 (= R85), E83 (≠ A86), W102 (= W105), Y134 (= Y139), D240 (= D245), F265 (= F270)
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
28% identity, 99% coverage: 5:507/507 of query aligns to 2:494/494 of 1bwfO
- binding phosphodifluoromethylphosphonic acid-adenylate ester: T12 (= T15), T13 (≠ S16), T262 (= T267), G305 (= G313), I308 (≠ L316), Q309 (≠ N317), A321 (= A329), G406 (= G414), N410 (≠ S418)
- binding glycerol: R82 (= R85), E83 (≠ A86), W102 (= W105), Y134 (= Y139), D240 (= D245), Q241 (= Q246), F265 (= F270)
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
28% identity, 99% coverage: 5:507/507 of query aligns to 2:498/498 of 1glfO
- binding adenosine-5'-diphosphate: R16 (= R19), G265 (= G266), T266 (= T267), G309 (= G313), G410 (= G414), A411 (≠ L415)
- binding glycerol: R82 (= R85), E83 (≠ A86), Y134 (= Y139), D244 (= D245)
- binding phosphate ion: G232 (≠ L233), G233 (= G234), R235 (≠ D236)
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
28% identity, 99% coverage: 5:507/507 of query aligns to 2:498/498 of 1bo5O
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
27% identity, 99% coverage: 5:507/507 of query aligns to 2:498/499 of 1bu6Y
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
28% identity, 99% coverage: 8:507/507 of query aligns to 3:489/489 of 1gldG
- binding adenosine-5'-diphosphate: R14 (= R19), G256 (= G266), T257 (= T267), G300 (= G313), A316 (= A329), G401 (= G414), A402 (≠ L415), N405 (≠ S418)
- binding glyceraldehyde-3-phosphate: T10 (= T15), R80 (= R85), E81 (≠ A86), Y132 (= Y139), D235 (= D245), F260 (= F270)
- binding manganese (ii) ion: D7 (= D12), R14 (= R19)
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
28% identity, 99% coverage: 8:507/507 of query aligns to 3:489/489 of 1glcG
- binding adenosine-5'-diphosphate: G256 (= G266), T257 (= T267), G300 (= G313), A316 (= A329), G401 (= G414), A402 (≠ L415), N405 (≠ S418)
- binding glyceraldehyde-3-phosphate: T10 (= T15), R80 (= R85), E81 (≠ A86), W100 (= W105), Y132 (= Y139), D235 (= D245), F260 (= F270)
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
28% identity, 99% coverage: 8:507/507 of query aligns to 3:489/489 of 1glbG
- binding adenosine-5'-diphosphate: R14 (= R19), G256 (= G266), T257 (= T267), G300 (= G313), I303 (≠ L316), A316 (= A329), G401 (= G414), A402 (≠ L415), N405 (≠ S418)
- binding glycerol: R80 (= R85), E81 (≠ A86), W100 (= W105), Y132 (= Y139), D235 (= D245), F260 (= F270)
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
29% identity, 95% coverage: 10:489/507 of query aligns to 8:498/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
29% identity, 95% coverage: 10:489/507 of query aligns to 8:498/513 of 6j9qA
Query Sequence
>RR42_RS16765 FitnessBrowser__Cup4G11:RR42_RS16765
MKTNRNVILAIDEGTSGTRAAVVAADGHVSCLEYTTLQVNTPRPGVVEQDANAVLEKTIA
VCRATIARARQAQLRIVALGIATQRATAVLWDTRSGRAIVPAMVWQDTRYAGELGALAPA
WDKTLLEQVGRPVGVRSPYLWAARHLRDTPEVAEALRAGSLAFGTIDTWLLWHLSTERAC
VTTPTNATSASAYVLAGHRYHLGWLDALGFPHALLPALRQDADDFGRTRAALLGIDVPIL
ACAGDQLAGAAGLGCLERGQSMCVHGTGSFVDLVIGPQPPAKAGLYDGTLTMTARRQHDV
SHLSVETFVATTGSALNWVCEKLRWFESAKQISALAATVDAARGVTFLPALTGLRVPQMQ
PEARASLTGISIASTQAEVAYAILEGIAHAVSSCMEANEEVAGVPVAELIVGGGLSGSDA
LLQIQADLTGMPIRRMRETDRASLRGIAFFAGSSGLLWDSLQDARATNETDAVFEPRLGA
DQRGERRALWHARVASELRHAQSFHHH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory