Comparing RR42_RS16840 FitnessBrowser__Cup4G11:RR42_RS16840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
32% identity, 76% coverage: 72:306/309 of query aligns to 72:301/305 of Q8K4H1
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
34% identity, 31% coverage: 81:176/309 of query aligns to 66:162/309 of 1qz3A
Sites not aligning to the query:
4ob6A Complex structure of esterase rppe s159a/w187h and substrate (s)-ac- cpa (see paper)
30% identity, 31% coverage: 81:177/309 of query aligns to 72:169/319 of 4ob6A
Sites not aligning to the query:
P95125 Carboxylic ester hydrolase LipN; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 37% coverage: 65:177/309 of query aligns to 115:225/376 of P95125
Sites not aligning to the query:
5mifC Crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum (see paper)
29% identity, 27% coverage: 89:172/309 of query aligns to 64:148/301 of 5mifC
Sites not aligning to the query:
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
33% identity, 31% coverage: 81:175/309 of query aligns to 58:153/307 of 6ieyA
Sites not aligning to the query:
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
25% identity, 69% coverage: 76:289/309 of query aligns to 55:278/309 of 4po3X
Sites not aligning to the query:
B5BLW5 Arylesterase; A-esterase; Paraoxonase; EC 3.1.1.2; EC 3.1.8.1 from Saccharolobus solfataricus (Sulfolobus solfataricus) (see paper)
27% identity, 47% coverage: 90:235/309 of query aligns to 77:231/306 of B5BLW5
Sites not aligning to the query:
4oukX Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
25% identity, 69% coverage: 76:289/309 of query aligns to 52:279/309 of 4oukX
Sites not aligning to the query:
4v2iA Biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp (see paper)
26% identity, 34% coverage: 89:194/309 of query aligns to 77:183/315 of 4v2iA
Sites not aligning to the query:
4n5iX Crystal structure of a c8-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
26% identity, 33% coverage: 76:177/309 of query aligns to 52:151/311 of 4n5iX
Sites not aligning to the query:
P24484 Lipase 2; Triacylglycerol lipase; EC 3.1.1.3 from Moraxella sp. (strain TA144) (see paper)
28% identity, 28% coverage: 91:177/309 of query aligns to 161:248/433 of P24484
>RR42_RS16840 FitnessBrowser__Cup4G11:RR42_RS16840
MSAQPSLASLARLPSQDPAFYAREYNNRANVPDNATHMAHWAELSRQVRKRAGWLEDLSY
AGAEPGPHAADERLDYFPAEPGATDGPPPLLVFVHGGYWRALDKRDHSLVANALPRCGVS
VAVINYSLCPAVTVETIVLQAVRSVAWLYRESGRLGHDKARIFVGGHSVGGHMAAMMLTT
LWPRVGRDLPADLVKGVVSVSGLHDLEPLRRADFLQVDLKLSARDVDRLSPAFLPPATDA
PLVTAVGGLEPGEYHRQTDLLRAAWLANAQAPGAAHVPMPDRHHFNVMHDFADGDSPLLL
AVRRMMGVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory