Comparing RR42_RS16940 FitnessBrowser__Cup4G11:RR42_RS16940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4h6dE Crystal structure of plp-soaked hmp synthase thi5 from s. Cerevisiae (see paper)
26% identity, 64% coverage: 47:252/323 of query aligns to 17:227/302 of 4h6dE
Sites not aligning to the query:
4h6dB Crystal structure of plp-soaked hmp synthase thi5 from s. Cerevisiae (see paper)
26% identity, 64% coverage: 47:252/323 of query aligns to 17:229/329 of 4h6dB
Sites not aligning to the query:
>RR42_RS16940 FitnessBrowser__Cup4G11:RR42_RS16940
MGFRIRSGKSLAVAVAAVVATLGAAGTAQAQATQVTLGMSGWTGFAPLTLADKAGIFKKH
GVDVDIKMIPQKDRHLALAAGAIQCAATTVETHVAWNANGVPITQIVQLDKSYGADGLAV
RGDVKGFADLKGKTIGVDAPGTAPYFGLAWMLKKNGMSLKDVKTTTLSPQAAAQAFVAGQ
NDAAMTYEPYLSSVRQNPDKGKILATTLDYPMVMDTLGCAPKWLKDNPKAAQALVDSYFE
ALDMIRQDPAKANDVMGAAVKQSGEQFAKSSAYLRWQDRDANRKFFGGELASFSKEAAQV
LLEIGVIRQVPDVTALYDARFIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory