Comparing RR42_RS16955 FitnessBrowser__Cup4G11:RR42_RS16955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
40% identity, 97% coverage: 11:392/395 of query aligns to 11:391/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
40% identity, 97% coverage: 11:392/395 of query aligns to 3:383/385 of Q9X2A5
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
44% identity, 91% coverage: 23:380/395 of query aligns to 24:384/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
44% identity, 90% coverage: 25:380/395 of query aligns to 26:384/400 of 4addA
Sites not aligning to the query:
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
40% identity, 96% coverage: 11:391/395 of query aligns to 1:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
41% identity, 96% coverage: 11:391/395 of query aligns to 3:375/375 of 2eh6A
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
40% identity, 94% coverage: 19:388/395 of query aligns to 20:390/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 94% coverage: 19:388/395 of query aligns to 25:395/405 of P40732
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
40% identity, 95% coverage: 17:392/395 of query aligns to 10:386/388 of 3nx3A
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
39% identity, 94% coverage: 19:388/395 of query aligns to 20:385/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
39% identity, 94% coverage: 19:388/395 of query aligns to 14:379/389 of 2pb0A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 17:394/395 of query aligns to 75:456/457 of Q9M8M7
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
36% identity, 96% coverage: 9:387/395 of query aligns to 8:385/390 of 8ht4B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 96% coverage: 18:395/395 of query aligns to 18:387/390 of A0QYS9
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
34% identity, 96% coverage: 14:391/395 of query aligns to 23:394/395 of Q5SHH5
7ta0A Human ornithine aminotransferase (hoat) soaked with 5-aminovaleric acid (see paper)
34% identity, 94% coverage: 20:391/395 of query aligns to 24:401/403 of 7ta0A
Sites not aligning to the query:
8ez1B Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
34% identity, 94% coverage: 20:391/395 of query aligns to 23:400/402 of 8ez1B
8ez1A Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
34% identity, 94% coverage: 20:391/395 of query aligns to 23:400/402 of 8ez1A
7tfpC Human ornithine aminotransferase cocrystallized with its inhibitor, (1s,3s)-3-amino-4-(difluoromethylene)cyclopentane-1-carboxylic acid. (see paper)
34% identity, 94% coverage: 20:391/395 of query aligns to 23:400/402 of 7tfpC
Sites not aligning to the query:
7lk0A Ornithine aminotransferase (oat) cocrystallized with its potent inhibitor - (s)-3-amino-4,4-difluorocyclopent-1-enecarboxylic acid (ss-1-148) (see paper)
34% identity, 94% coverage: 20:391/395 of query aligns to 23:400/402 of 7lk0A
Sites not aligning to the query:
>RR42_RS16955 FitnessBrowser__Cup4G11:RR42_RS16955
MAFAEYPVQSLMYITNRPELVFTEGKGSWLTDHNGKRYLDFVQGWAVNCLGHSNQAMIDA
LVDQSKKLFNPSPAFYNEPMLRLARQLTDASCFDKVFFANSGAEANEGAIKLARKWGRKH
KNGAFEIITMDHSFHGRTLATMSASGKAGWDTIFAPQVPGFPKADLNDLASVEKLINDKT
VAIMLEPVQGEGGVIPASREFMQGLRKLADQHKLLFIVDEVQTGCGRCGTMFAYELSGVE
PDIMTLGKGIGGGVPLAALLCKAEVASFEAGDQGGTYNGNPVMTAVGSAVISQLTAPGFL
QSVQDKGAYLREQLLALTSEFGLGGERGEGLLRALVLNKDIGPQLVEEARDMQPQGLLLN
SPRPNLLRFMPALNVTIEEIDQMISMLRTLLKKLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory