SitesBLAST
Comparing RR42_RS17550 FitnessBrowser__Cup4G11:RR42_RS17550 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1drvA Escherichia coli dhpr/acnadh complex (see paper)
61% identity, 100% coverage: 1:265/265 of query aligns to 3:268/270 of 1drvA
- active site: H156 (= H153), K160 (= K157)
- binding 3-acetylpyridine adenine dinucleotide: G9 (= G7), G12 (= G10), R13 (= R11), M14 (= M12), E35 (≠ D33), F76 (= F73), T77 (= T74), R78 (= R75), G81 (= G78), G99 (= G96), A124 (= A121), F126 (≠ M123), R237 (= R234)
1druA Escherichia coli dhpr/nadh complex (see paper)
61% identity, 100% coverage: 1:265/265 of query aligns to 3:268/270 of 1druA
- active site: H156 (= H153), K160 (= K157)
- binding nicotinamide-adenine-dinucleotide: G9 (= G7), G12 (= G10), R13 (= R11), M14 (= M12), E35 (≠ D33), R36 (≠ V34), F76 (= F73), T77 (= T74), R78 (= R75), G81 (= G78), G99 (= G96), T100 (= T97), T101 (= T98), A124 (= A121), N125 (= N122), F126 (≠ M123), F240 (≠ Y237)
1arzA Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
61% identity, 100% coverage: 1:265/265 of query aligns to 3:268/270 of 1arzA
1drwA Escherichia coli dhpr/nhdh complex (see paper)
61% identity, 100% coverage: 1:265/265 of query aligns to 5:270/272 of 1drwA
- active site: H158 (= H153), K162 (= K157)
- binding nicotinamide purin-6-ol-dinucleotide: G11 (= G7), G14 (= G10), R15 (= R11), M16 (= M12), E37 (≠ D33), R38 (≠ V34), F78 (= F73), T79 (= T74), R80 (= R75), G101 (= G96), T102 (= T97), T103 (= T98), A126 (= A121), N127 (= N122), F128 (≠ M123), F242 (≠ Y237)
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
61% identity, 100% coverage: 1:265/265 of query aligns to 5:270/272 of 1dihA
- active site: H158 (= H153), K162 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G7), G14 (= G10), R15 (= R11), M16 (= M12), R38 (≠ V34), F78 (= F73), T79 (= T74), R80 (= R75), G83 (= G78), G101 (= G96), T103 (= T98), N127 (= N122), F128 (≠ M123), R239 (= R234), F242 (≠ Y237)
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
61% identity, 100% coverage: 1:265/265 of query aligns to 2:267/269 of 1arzB
- active site: H155 (= H153), K159 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G7), G10 (≠ S9), G11 (= G10), R12 (= R11), M13 (= M12), E34 (≠ D33), F75 (= F73), T76 (= T74), R77 (= R75), G80 (= G78), H84 (= H82), G98 (= G96), T100 (= T98), A123 (= A121), N124 (= N122), F125 (≠ M123), F239 (≠ Y237)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T98), H156 (= H154), K159 (= K157), S164 (= S162), G165 (= G163), T166 (= T164), F239 (≠ Y237)
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
61% identity, 100% coverage: 1:265/265 of query aligns to 6:271/273 of P04036
- G12 (= G7) binding
- GRM 15:17 (= GRM 10:12) binding
- RM 16:17 (= RM 11:12) binding
- E38 (≠ D33) binding
- R39 (≠ V34) binding
- TR 80:81 (= TR 74:75) binding
- GTT 102:104 (= GTT 96:98) binding ; binding
- AANF 126:129 (≠ SANM 120:123) binding
- F129 (≠ M123) binding
- H159 (= H153) mutation H->A,Q: 135 to 200-fold reduction in catalytic activity.
- K163 (= K157) binding ; mutation K->A,C,Q: 625 to 830-fold reduction in catalytic activity.
- R240 (= R234) binding
- F243 (≠ Y237) binding
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
57% identity, 100% coverage: 2:265/265 of query aligns to 3:268/268 of 4ywjA
- active site: H156 (= H153), K160 (= K157)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), R12 (= R11), M13 (= M12), D35 (= D33), R36 (≠ V34), F76 (= F73), T77 (= T74), V81 (≠ G78), G99 (= G96), T101 (= T98), A124 (= A121), N125 (= N122), F126 (≠ M123), R237 (= R234), F240 (≠ Y237)
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
48% identity, 100% coverage: 1:265/265 of query aligns to 2:267/269 of 5tejB
- active site: H155 (= H153), K159 (= K157)
- binding 2,5 Furan Dicarboxylic Acid: T100 (= T98), H156 (= H154), K159 (= K157), S164 (= S162), G165 (= G163), T166 (= T164)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), R12 (= R11), M13 (= M12), E34 (≠ D33), R35 (≠ V34), F75 (= F73), T76 (= T74), S80 (≠ G78), G98 (= G96), T100 (= T98), P123 (≠ A121), N124 (= N122), Y125 (≠ M123), F239 (≠ Y237)
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
48% identity, 100% coverage: 1:265/265 of query aligns to 2:267/269 of 5tejA
- active site: H155 (= H153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), R12 (= R11), M13 (= M12), E34 (≠ D33), R35 (≠ V34), F75 (= F73), T76 (= T74), S80 (≠ G78), G98 (= G96), T100 (= T98), P123 (≠ A121)
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
49% identity, 100% coverage: 1:264/265 of query aligns to 2:266/266 of 5temA
- active site: H155 (= H153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), R12 (= R11), M13 (= M12), E34 (≠ D33), R35 (≠ V34), F75 (= F73), T76 (= T74), S80 (≠ G78), G98 (= G96), T100 (= T98), P123 (≠ A121), N124 (= N122), Y125 (≠ M123), F239 (≠ Y237)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T98), P123 (≠ A121), H156 (= H154), K159 (= K157), S164 (= S162), G165 (= G163), T166 (= T164)
3ijpA Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
42% identity, 100% coverage: 1:264/265 of query aligns to 2:266/266 of 3ijpA
- active site: H155 (= H153), K159 (= K157)
- binding sodium ion: I21 (≠ V20), Q22 (≠ L21), R24 (≠ T23), V27 (= V26)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), N10 (≠ S9), G11 (= G10), R12 (= R11), M13 (= M12), R35 (≠ V34), F75 (= F73), S76 (≠ T74), Q77 (≠ R75), A80 (≠ G78), G98 (= G96), T100 (= T98), G123 (≠ A121), N124 (= N122), M125 (= M123), F239 (≠ Y237)
3ijpB Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
41% identity, 100% coverage: 1:265/265 of query aligns to 2:267/267 of 3ijpB
Q9X1K8 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 99% coverage: 1:262/265 of query aligns to 1:212/216 of Q9X1K8
1vm6B Crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
31% identity, 99% coverage: 1:262/265 of query aligns to 6:217/218 of 1vm6B
- active site: H132 (= H153), K136 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G7), S14 (= S9), G15 (= G10), R16 (= R11), M17 (= M12), D37 (= D33), V38 (= V34), F53 (= F73), S54 (≠ T74), S55 (≠ R75), E57 (= E77), A58 (≠ G78), G76 (= G96), T78 (= T98), Y101 (≠ A121), N102 (= N122), F103 (≠ M123), F192 (≠ Y237)
5z2fA NADPH/pda bound dihydrodipicolinate reductase from paenisporosarcina sp. Tg-14 (see paper)
24% identity, 98% coverage: 3:262/265 of query aligns to 5:265/265 of 5z2fA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R11 (≠ S9), G12 (= G10), K13 (≠ R11), M14 (= M12), D35 (= D33), H36 (≠ G41), K37 (≠ Q42), L76 (≠ F73), T77 (= T74), G99 (= G96), T100 (= T97), T101 (= T98), P126 (≠ A121), N127 (= N122), F128 (≠ M123)
- binding pyridine-2,6-dicarboxylic acid: P126 (≠ A121), H155 (= H153), H156 (= H154), K159 (= K157), S164 (= S162), G165 (= G163), T166 (= T164), A215 (≠ G212)
5z2eA Dipicolinate bound dihydrodipicolinate reductase from paenisporosarcina sp. Tg-14 (see paper)
24% identity, 98% coverage: 3:262/265 of query aligns to 5:265/265 of 5z2eA
5eesA Crystal structure of dapb in complex with NADP+ from corynebacterium glutamicum (see paper)
29% identity, 100% coverage: 1:264/265 of query aligns to 2:247/247 of 5eesA
- active site: H133 (= H153), K137 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G11 (= G10), R12 (= R11), V13 (≠ M12), G34 (≠ D33), V35 (= V34), F53 (= F73), T54 (= T74), G76 (= G96), T78 (= T98), P104 (≠ A121), N105 (= N122), F106 (≠ M123), F220 (≠ Y237)
- binding sulfate ion: H134 (= H154), K137 (= K157), K137 (= K157), G143 (= G163), T144 (= T164)
5eerA Crystal structure of dapb from corynebacterium glutamicum (see paper)
29% identity, 100% coverage: 1:264/265 of query aligns to 2:247/247 of 5eerA
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
30% identity, 100% coverage: 1:264/265 of query aligns to 1:244/245 of 1p9lA
- active site: H132 (= H153), K136 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G7 (= G7), G10 (= G10), K11 (≠ R11), V12 (≠ M12), D33 (= D33), A34 (≠ V34), F52 (= F73), T53 (= T74), V57 (≠ G78), G75 (= G96), T77 (= T98), P103 (≠ A121), N104 (= N122), F105 (≠ M123), F217 (≠ Y237)
- binding pyridine-2,6-dicarboxylic acid: H133 (= H154), K136 (= K157), S141 (= S162), G142 (= G163), T143 (= T164), A192 (≠ G212)
Query Sequence
>RR42_RS17550 FitnessBrowser__Cup4G11:RR42_RS17550
MNIAIAGASGRMGRMLIEHVLATEGVTLSGALDVPGAPALGQDAGLLLGRATGVVITSDI
EAALAGADCLIDFTRPEGTLVHLAAARRLGVKVVTGTTGFDDAGRAAIAEAAKHIGVVFS
ANMSVGVNATFKLLEVAAKLLSSGYDIEVIEAHHRHKVDAPSGTALAMGEVVAKALGRDL
KTCGVFAREGHTGPRDPNSIGFATVRGGDIVGDHTVMFAGTGERIEITHKSSSRQSYAEG
ALRAARFLADKPTGLFDMQDVLGLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory