SitesBLAST
Comparing RR42_RS17610 FitnessBrowser__Cup4G11:RR42_RS17610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
62% identity, 97% coverage: 19:770/774 of query aligns to 3:754/759 of P76558
- K56 (≠ N72) modified: N6-acetyllysine
6zngF Maeb full-length acetyl-coa bound state (see paper)
46% identity, 96% coverage: 25:770/774 of query aligns to 8:743/753 of 6zngF
- active site: Y38 (= Y55), A74 (= A91), K93 (= K110), E135 (= E152), D136 (= D153), D160 (= D177), D161 (= D178), N286 (= N303)
- binding acetyl coenzyme *a: R511 (≠ M536), K514 (≠ Q539), Y552 (≠ T578), A553 (= A579), R557 (= R583), L560 (≠ D586), P571 (≠ Y596), T590 (≠ H615), V591 (= V616), N592 (= N617), L593 (≠ I618), Y625 (≠ H650), Q659 (≠ H685), L690 (≠ I716), N694 (= N720), Q724 (≠ T751)
6zn7A Maeb malic enzyme domain apoprotein (see paper)
57% identity, 52% coverage: 25:423/774 of query aligns to 7:405/405 of 6zn7A
- active site: Y37 (= Y55), A73 (= A91), K92 (= K110), E134 (= E152), D135 (= D153), D159 (= D177), D160 (= D178), N285 (= N303)
- binding magnesium ion: E134 (= E152), D135 (= D153), D160 (= D178)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T164 (= T182), N191 (≠ S209), A193 (= A211), G194 (= G212), A195 (= A213), S196 (≠ A214), D218 (= D236), S219 (≠ L237), K235 (= K253), L260 (= L278), S261 (= S279), V262 (≠ A280), M283 (≠ L301), N285 (= N303), V315 (= V333)
6zn4A Maeb malic enzyme domain apoprotein (see paper)
57% identity, 52% coverage: 25:423/774 of query aligns to 7:405/406 of 6zn4A
5ceeA Malic enzyme from candidatus phytoplasma aywb in complex with NAD and mg2+ (see paper)
46% identity, 52% coverage: 21:420/774 of query aligns to 1:385/387 of 5ceeA
- active site: Y34 (= Y55), A70 (= A91), K89 (= K110), E131 (= E152), D132 (= D153), D156 (= D177), D157 (= D178), N283 (= N303)
- binding magnesium ion: E131 (= E152), D132 (= D153), D157 (= D178)
- binding nicotinamide-adenine-dinucleotide: T161 (= T182), N188 (≠ S209), G189 (= G210), G191 (= G212), A193 (= A214), D213 (= D236), K214 (≠ L237), V258 (≠ L278), S259 (= S279), I263 (≠ V283), L281 (= L301), N283 (= N303), V312 (= V333), N314 (= N335)
2dvmA NAD complex structure of ph1275 protein from pyrococcus horikoshii
43% identity, 56% coverage: 21:455/774 of query aligns to 1:430/438 of 2dvmA
- active site: Y37 (= Y55), R73 (≠ A91), K92 (= K110), E134 (= E152), D135 (= D153), D159 (= D177), D160 (= D178), N296 (= N303)
- binding nicotinamide-adenine-dinucleotide: T164 (= T182), G194 (= G212), A195 (= A213), A196 (= A214), V217 (≠ T235), E218 (≠ D236), L219 (= L237), P224 (vs. gap), F269 (≠ L278), T270 (≠ S279), L294 (= L301), N296 (= N303), N327 (= N335)
2a9fA Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
50% identity, 43% coverage: 35:369/774 of query aligns to 18:350/383 of 2a9fA
2haeD Crystal structure of a putative malic enzyme (malate oxidoreductase)
43% identity, 51% coverage: 25:415/774 of query aligns to 2:373/373 of 2haeD
2haeB Crystal structure of a putative malic enzyme (malate oxidoreductase)
43% identity, 51% coverage: 25:415/774 of query aligns to 2:373/373 of 2haeB
- active site: Y31 (= Y55), A67 (= A91), K86 (= K110), E128 (= E152), D129 (= D153), D153 (= D177), D154 (= D178), N280 (= N303)
- binding nicotinamide-adenine-dinucleotide: T158 (= T182), N185 (≠ S209), G188 (= G212), A189 (= A213), A190 (= A214), D210 (= D236), R211 (≠ L237), V255 (≠ L278), S256 (= S279), R257 (≠ A280), L278 (= L301), A279 (= A302), N280 (= N303), N311 (= N335)
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
31% identity, 40% coverage: 462:770/774 of query aligns to 20:324/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 45% coverage: 430:774/774 of query aligns to 390:713/714 of Q8ZND6
Sites not aligning to the query:
- 252 R→H: Increases speed of forward and back reactions by 2-3 fold. Not inhibited by NADH.
- 273 G→D: Increases speed of forward and back reactions by 2-3 fold.
- 294 M→I: Slightly decreases speed of forward and back reactions.
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
31% identity, 41% coverage: 454:774/774 of query aligns to 13:338/339 of 6ioxA
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
26% identity, 43% coverage: 444:773/774 of query aligns to 2:330/332 of 2af3C
- binding coenzyme a: R86 (≠ M536), S127 (≠ T578), L131 (= L582), V135 (≠ D586), L146 (≠ V595), A147 (≠ Y596), G172 (≠ H615), M173 (≠ V616), M173 (≠ V616), V174 (≠ N617), E175 (≠ I618), N278 (= N720), Y281 (= Y723), K282 (≠ N724), Q285 (≠ K727), G294 (= G737), P295 (= P738), T297 (≠ L740), D306 (≠ I749), L307 (= L750), S308 (≠ T751)
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
26% identity, 43% coverage: 444:773/774 of query aligns to 3:331/333 of P38503
- C159 (≠ R607) mutation to A: Loss of activity.; mutation to S: No loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P40927 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Columba livia (Rock dove) (see 3 papers)
26% identity, 42% coverage: 48:374/774 of query aligns to 84:482/557 of P40927
- D141 (≠ N88) mutation to N: Increases Km for manganese 14-fold. Increases Km for malate 5-fold.
- R144 (≠ A91) binding ; binding
- K162 (= K110) binding ; mutation to A: Decreases kcat 235-fold. no effect on Km for NADP.
- D194 (= D131) mutation to N: No effect on Km for manganese. Increases Km for malate 8-fold.
- E234 (= E152) binding
- D235 (= D153) binding
- N238 (≠ A156) binding
- D258 (= D178) binding
- AGEA 291:294 (≠ AGAA 211:214) binding
- S325 (≠ L237) binding
- K340 (= K253) mutation to A: Increases Km for NADP 65-fold. No effect on kcat.
- N397 (= N303) binding
- N443 (= N335) binding ; binding
- D464 (≠ R356) mutation to N: No effect.
1gq2A Malic enzyme from pigeon liver (see paper)
26% identity, 42% coverage: 48:374/774 of query aligns to 83:481/555 of 1gq2A
- active site: Y90 (= Y55), R143 (≠ A91), K161 (= K110), E233 (= E152), D234 (= D153), D256 (= D177), D257 (= D178), N396 (= N303)
- binding manganese (ii) ion: K161 (= K110), E233 (= E152), D234 (= D153), D257 (= D178)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R143 (≠ A91), G146 (= G94), N237 (≠ A156), T261 (= T182), G289 (= G210), A290 (= A211), G291 (= G212), E292 (≠ A213), A293 (= A214), V322 (≠ T235), D323 (= D236), S324 (≠ L237), A368 (≠ S279), I370 (vs. gap), L394 (= L301), N396 (= N303), G440 (≠ V333), N441 (= N334), N442 (= N335)
- binding oxalate ion: R143 (≠ A91), L145 (= L93), D257 (= D178), N396 (= N303), N442 (= N335)
7x11A Crystal structure of me1 in complex with NADPH (see paper)
25% identity, 41% coverage: 48:368/774 of query aligns to 90:482/564 of 7x11A
- binding 6-[(7-methyl-2-propyl-imidazo[4,5-b]pyridin-4-yl)methyl]-2-[2-(1H-1,2,3,4-tetrazol-5-yl)phenyl]-1,3-benzothiazole: N244 (≠ A156), F248 (= F160), I265 (≠ Q179), Q266 (≠ H180), L302 (= L216), G303 (≠ A217), H306 (≠ D220), E345 (= E252), D470 (≠ R356)
- binding manganese (ii) ion: E240 (= E152), D241 (= D153), D264 (= D178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R150 (≠ A91), N244 (≠ A156), T268 (= T182), A297 (= A211), G298 (= G212), E299 (≠ A213), A300 (= A214), D330 (= D236), S331 (≠ L237), K332 (≠ A238), K346 (= K253), V374 (≠ L278), A375 (≠ S279), A376 (= A280), I377 (vs. gap), L401 (= L301), S402 (≠ A302), N403 (= N303), G447 (≠ V333)
P16243 NADP-dependent malic enzyme, chloroplastic; NADP-ME; EC 1.1.1.40 from Zea mays (Maize) (see 3 papers)
24% identity, 49% coverage: 51:431/774 of query aligns to 180:622/636 of P16243
- R237 (≠ A91) mutation to L: Decreases kcat 530-fold. Increases Km for NADP 36-fold and Km for malate 10-fold.
- K255 (= K110) mutation to I: Increases Km for malate 10-fold, and Km for NADP 15-fold. Decreases kcat 200-fold.
- E339 (= E163) mutation to A: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
- A387 (= A214) mutation to G: Decreases kcat 48-fold. Increases Km for NADP 4-fold. Increases Km for malate 6-fold.
- A392 (≠ L219) mutation to G: No effect on kcat. Increases Km for NADP 3.5-fold. Increases Km for malate 2.5-fold.
- KK 435:436 (≠ KA 253:254) mutation to LL: No effect on kcat and on Km for malate. Increases Km for NADP 9-fold.
- Q503 (vs. gap) mutation to E: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
- L544 (≠ I342) mutation to F: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
Sites not aligning to the query:
- 140 F→I: Decreases kcat 8-fold. Decreases Km for NADP 2-fold, increases Km for malate 2-fold.
8eyoA Crystal structure of human mitochondrial NADP+ malic enzyme 3 with NADP bound (see paper)
27% identity, 38% coverage: 85:375/774 of query aligns to 136:482/562 of 8eyoA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T260 (= T182), Q287 (≠ S209), A289 (= A211), G290 (= G212), E291 (≠ A213), A292 (= A214), D322 (= D236), S323 (≠ L237), K338 (= K253), V366 (≠ L278), A367 (≠ S279), I369 (vs. gap), L393 (= L301), S394 (≠ A302), N395 (= N303), G439 (≠ V333), N441 (= N335)
6w49A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec010) (see paper)
25% identity, 37% coverage: 83:372/774 of query aligns to 131:481/543 of 6w49A
Sites not aligning to the query:
Query Sequence
>RR42_RS17610 FitnessBrowser__Cup4G11:RR42_RS17610
MTSPQQPTPQDDLKQQQREALRKAALEYHEFPIPGKISVTPTKPLSNQRDLALAYSPGVA
YACEEIVADPLNAFRYTARGNLVGVITNGTAVLGLGDIGPAASKPVMEGKAGLFKKFAGI
DVFDIELDEKDPEKLVQIIAALEPTFGGINLEDIKAPECFYVERKLRERMKIPVFHDDQH
GTAIVVGAAVVNGLTVVGKDIGKVKLVASGAGAAALACLDLLLDLGMKLENIWVTDLAGV
VYEGRAELMDPEKARFAQKTDKRKLAEVIDGADIFLGLSAAGVLKQDMVQRMADKPLVLA
LANPNPEILPELVKEVRPDAVIATGRTDYPNQVNNVLCFPFIFRGALDCGATTITREMEV
AAAHAIAELARQEQSDIVATAYGIQDLSFGPEYLIPKPFDPRLIVKIAPAVAEAAMKSGV
AARPIKDMDAYRLQLQQFVYHSGTLMKPIYAAARQVDMEKKRIVFAEGEEERVLRAVQVI
VDEKLANPILVGRPAVIAHRIERFGLRLRGGIDFTVVNPEHDARFRDYSEAYFKMMARQG
ITQQYAKLEMRRRTTLIGAMLVKQGEADGMICGTVSTTAAHLRYIDQVLGGSSEVYAAMN
GLVLPGRQIFLVDTHVNIDPTAGQLAEITLMAAEELKRFGIVPKVALMSHSNFGTSEAPS
AQKMRETLAILRERAPDLEVDGEMHGDCALDPKLRDTLVPDGTLKGEANLLVCPNIDAAN
IAYNLLKVAAGNNVAIGPILLGVKAPVHILTPSATVRRIVNMTSLVVVDAAAKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory