Comparing RR42_RS18195 FitnessBrowser__Cup4G11:RR42_RS18195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 93% coverage: 8:317/332 of query aligns to 7:311/326 of Q8RDH4
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 98% coverage: 4:330/332 of query aligns to 2:330/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 93% coverage: 8:317/332 of query aligns to 6:300/310 of 4fwiB
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
34% identity, 79% coverage: 3:263/332 of query aligns to 1:246/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 79% coverage: 3:263/332 of query aligns to 1:246/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
34% identity, 79% coverage: 3:263/332 of query aligns to 1:246/250 of 7z16I
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 76% coverage: 12:262/332 of query aligns to 29:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 76% coverage: 12:262/332 of query aligns to 29:264/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
30% identity, 74% coverage: 12:256/332 of query aligns to 29:258/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
31% identity, 75% coverage: 16:265/332 of query aligns to 13:247/375 of 2d62A
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 77% coverage: 8:263/332 of query aligns to 6:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 77% coverage: 8:263/332 of query aligns to 6:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 77% coverage: 8:263/332 of query aligns to 6:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 77% coverage: 8:263/332 of query aligns to 6:240/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 75% coverage: 16:263/332 of query aligns to 8:238/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 76% coverage: 13:263/332 of query aligns to 8:243/343 of P30750
Sites not aligning to the query:
1g291 Malk (see paper)
31% identity, 74% coverage: 20:265/332 of query aligns to 14:244/372 of 1g291
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 50% coverage: 89:255/332 of query aligns to 87:247/258 of P02915
Sites not aligning to the query:
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
38% identity, 50% coverage: 89:255/332 of query aligns to 83:243/258 of 1b0uA
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 76% coverage: 13:263/332 of query aligns to 9:244/344 of 6cvlD
>RR42_RS18195 FitnessBrowser__Cup4G11:RR42_RS18195
MSKPTLVVEGLKTQFFTRGGVARAVDDVSFSVGRGEIMGLVGESGSGKSMTGYSIMGLID
PPGKVVDGRIELTSRDGVTRDLRNLTPAQMRDVRGNRIAMIFQDPMMTLNPVLRIDTQMI
EAVLAHEKVDKAVARERSRNALARVGIPSPDERLRAYPHQFSGGMRQRVAIAIALLNKPD
LIIADEPTTALDVTIQGQILYEMQKLCRESGTALIWITHDLSVVAGLADTVCVMYAGKIV
EAGDVRQVLERPEHPYTHGLISSAPSRNPRGAPLRQIPGMTPSLLNLPAGCAFRERCTYA
TDVCKTAPPLDTAADGRRLRCFHPVLSQQEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory